PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.011G114200.1 | ||||||||
Common Name | B456_011G114200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 147aa MW: 16630.6 Da PI: 9.0117 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95 | 5.4e-30 | 72 | 130 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K+vk+s++pr+YY+C+s gC+vkk++er+++d ++v++tYeg+Hnh Gorai.011G114200.1 72 MDDGYKWRKYGKKPVKNSPNPRNYYKCSSGGCNVKKRIERDRDDHSYVITTYEGSHNHY 130 69********************************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.8E-32 | 58 | 131 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.96E-27 | 64 | 132 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.307 | 67 | 132 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.7E-32 | 72 | 131 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.0E-23 | 73 | 129 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MSDYLMLDGG VFEEDSSSQS IASSEKGLGG GNEISGATSK TPIIKCKTEA REKKLEQRHR 60 VAFITKSEIE VMDDGYKWRK YGKKPVKNSP NPRNYYKCSS GGCNVKKRIE RDRDDHSYVI 120 TTYEGSHNHY SPFTVYYNQM PPNAWT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-24 | 65 | 132 | 10 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 5e-24 | 65 | 132 | 10 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF669839 | 0.0 | KF669839.1 Gossypium hirsutum WRKY transcription factor 115 (WRKY115) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012453269.1 | 1e-105 | PREDICTED: uncharacterized protein LOC105775290 | ||||
Refseq | XP_016700548.1 | 1e-106 | PREDICTED: probable WRKY transcription factor 51 | ||||
Swissprot | Q93WU9 | 1e-42 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A0D2VL90 | 1e-105 | A0A0D2VL90_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.011G114200.1 | 1e-106 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5711 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 8e-42 | WRKY DNA-binding protein 51 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.011G114200.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|