PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.011G035500.2 | ||||||||
Common Name | B456_011G035500, LOC105776890 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 247aa MW: 28409.1 Da PI: 9.6487 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.9 | 2e-31 | 24 | 73 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+ Gorai.011G035500.2 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYA 73 79***********************************************8 PP | |||||||
2 | K-box | 113.5 | 2.1e-37 | 91 | 187 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 s++ s++e +a+ +qqe++kL+++i+nLq+ +Rh+lGe+++ L +keL++Le++Lek++++iRskKnell+++ie++qkke +l+++n+ L Gorai.011G035500.2 91 SNTGSVAEVNAQFYQQEADKLRNQIRNLQNINRHMLGESVGGLPMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKKEIDLHNNNQLL 181 3344499************************************************************************************ PP K-box 95 rkklee 100 r+k++e Gorai.011G035500.2 182 RAKIAE 187 ***986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.3E-42 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 34.076 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.01E-45 | 17 | 91 | No hit | No description |
SuperFamily | SSF55455 | 4.45E-34 | 17 | 105 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.1E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-26 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.1E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.1E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.6E-27 | 100 | 185 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.128 | 101 | 191 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MVYPNESLED SPQKKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 IVFSNRGRLY EYANNSVKAT IERYKKASDS SNTGSVAEVN AQFYQQEADK LRNQIRNLQN 120 INRHMLGESV GGLPMKELKS LESRLEKGIS RIRSKKNELL FAEIEYMQKK EIDLHNNNQL 180 LRAKIAENER KQQSMNLMPG GSSNNFEDIH SQPYDSRNYF QVDALQPAAN YYNPQQQQDQ 240 IVLQLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-21 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gra.1551 | 0.0 | flower| flowering |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Detected early in the floral meristem but mostly expressed in stamen and carpel primordia. {ECO:0000269|PubMed:1675158}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269|PubMed:15254538, ECO:0000269|PubMed:19956801}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269|PubMed:10198637, ECO:0000269|PubMed:11058164, ECO:0000269|PubMed:1675158, ECO:0000269|PubMed:17794879, ECO:0000269|PubMed:18281509, ECO:0000269|PubMed:19783648, ECO:0000269|PubMed:9783581}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF190547 | 0.0 | EF190547.1 Gossypium hirsutum MADS-box protein MADS4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012455289.1 | 0.0 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 | ||||
Refseq | XP_012455290.1 | 0.0 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 | ||||
Refseq | XP_012455291.1 | 0.0 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 | ||||
Swissprot | P17839 | 1e-123 | AG_ARATH; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A0D2ULS6 | 1e-180 | A0A0D2ULS6_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.011G035500.1 | 0.0 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-113 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.011G035500.2 |
Entrez Gene | 105776890 |
Publications ? help Back to Top | |||
---|---|---|---|
|