PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.011G029400.2 | ||||||||
Common Name | B456_011G029400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 147aa MW: 16751.4 Da PI: 7.8029 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 138.5 | 1.9e-43 | 60 | 137 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cqve+C+ad+++ak+yhrrhkvCe+h+kapvv v+g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++ Gorai.011G029400.2 60 ACQVENCTADMTDAKRYHRRHKVCEFHAKAPVVRVAGIHQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKSSS 137 5**************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 1.7E-62 | 5 | 146 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.1E-34 | 55 | 122 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.889 | 58 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.96E-40 | 59 | 139 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.1E-33 | 61 | 134 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MQNPEMATSK AEGKRRLKEM AEEEEEEEED EDNSTTGDDD KKKKGKRGSS TVVGGSCPPA 60 CQVENCTADM TDAKRYHRRH KVCEFHAKAP VVRVAGIHQR FCQQCSRFHE LSEFDETKRS 120 CRRRLAGHNE RRRKSSSEYH GEGSNY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-38 | 54 | 134 | 4 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ622311 | 0.0 | KJ622311.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012455582.1 | 1e-100 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38741 | 6e-54 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A0D2RE06 | 1e-103 | A0A0D2RE06_GOSRA; Squamosa promoter-binding-like protein | ||||
TrEMBL | A0A0D2SZ40 | 1e-102 | A0A0D2SZ40_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.011G029400.1 | 1e-103 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 6e-46 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.011G029400.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|