PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.010G159300.1 | ||||||||
Common Name | B456_010G159300, LOC105774797 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 168aa MW: 18493.1 Da PI: 9.3384 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 122.9 | 1.1e-38 | 43 | 100 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++k+++cprC s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Gorai.010G159300.1 43 PDKIIPCPRCRSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 100 68999***************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-25 | 42 | 92 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 7.4E-32 | 45 | 100 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.248 | 47 | 101 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 49 | 85 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MVIMDTQESG QGIKLFGTTI TLHGRQVNGE LNKADHPTVD KRPDKIIPCP RCRSMETKFC 60 YFNNYNVNQP RHFCKGCQRY WTAGGALRNV PVGAGRRKAK PPGPGLGLGG FQEGCLYDGS 120 SAVQQFEVEG MVLDEWHIAA TNGGGFQQVF PMKRRRISCS AAQLQPY* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 152 | 156 | KRRRI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012452825.1 | 1e-124 | PREDICTED: dof zinc finger protein DOF1.5 | ||||
Swissprot | P68350 | 5e-59 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | A0A0D2UFK5 | 1e-122 | A0A0D2UFK5_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A2P5SSU3 | 1e-122 | A0A2P5SSU3_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.010G159300.1 | 1e-123 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2809 | 26 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 2e-49 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.010G159300.1 |
Entrez Gene | 105774797 |
Publications ? help Back to Top | |||
---|---|---|---|
|