PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.009G354900.1

Common Name

B456_009G354900

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 224aa MW: 25726.5 Da PI: 9.0939

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.009G354900.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	167	6.3e-52	11	135	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lp+GfrFhP+deelv++yL +kv+ ++ +++ + evd++k+ePwd+p++++ ++kewyf+s+rd+kyatg r+nrat+sgyWkatgkdk+ Gorai.009G354900.1 11 LPAGFRFHPRDEELVCDYLMRKVALTD--TFQLMIEVDLNKCEPWDIPETARVNSKEWYFYSQRDRKYATGLRTNRATTSGYWKATGKDKA 99 799******************9988..346799*********88888999******************************* PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 v+s kg+ vg++ktLvfy+grapkg+k+dWvmhe+rl Gorai.009G354900.1 100 VHS-KGTIVGMRKTLVFYHGRAPKGTKSDWVMHEFRL 135 .999***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.4E-58	3	156	IPR003441	NAC domain
PROSITE profile	PS51005	55.174	11	156	IPR003441	NAC domain
Pfam	PF02365	6.5E-27	12	135	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 224 aa Download sequence Send to blast
MSNIRLVEAK LPAGFRFHPR DEELVCDYLM RKVALTDTFQ LMIEVDLNKC EPWDIPETAR 60 VNSKEWYFYS QRDRKYATGL RTNRATTSGY WKATGKDKAV HSKGTIVGMR KTLVFYHGRA 120 PKGTKSDWVM HEFRLQPTSN VSTLKEDWVL CRMLHKTKEI SKNPSIMGSS YDDIGSSPLP 180 PLMDSFISFH QPNLDDKYEQ QVPDSPICPQ TKGTLFSPIW TQI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-54	6	162	12	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-54	6	162	12	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-54	6	162	12	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-54	6	162	12	171	NO APICAL MERISTEM PROTEIN
3swm_A	1e-54	6	162	15	174	NAC domain-containing protein 19
3swm_B	1e-54	6	162	15	174	NAC domain-containing protein 19
3swm_C	1e-54	6	162	15	174	NAC domain-containing protein 19
3swm_D	1e-54	6	162	15	174	NAC domain-containing protein 19
3swp_A	1e-54	6	162	15	174	NAC domain-containing protein 19
3swp_B	1e-54	6	162	15	174	NAC domain-containing protein 19
3swp_C	1e-54	6	162	15	174	NAC domain-containing protein 19
3swp_D	1e-54	6	162	15	174	NAC domain-containing protein 19
4dul_A	1e-54	6	162	12	171	NAC domain-containing protein 19
4dul_B	1e-54	6	162	12	171	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269\|PubMed:11114891}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269\|PubMed:11114891}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by auxin.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012441072.1	1e-155	PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 21/22
Swissprot	Q84TE6	2e-87	NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBL	A0A0D2QTK3	1e-168	A0A0D2QTK3_GOSRA; Uncharacterized protein
STRING	Gorai.009G354900.1	1e-168	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3619	28	59

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G56010.2	7e-90	NAC domain containing protein 1

Link Out ? help Back to Top
Phytozome	Gorai.009G354900.1

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Le Hénanff G, et al. Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance. J. Exp. Bot., 2013. 64(16): p. 4877-93 [PMID:24043850] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Huo X,Wang C,Teng Y,Liu X Identification of miRNAs associated with dark-induced senescence in Arabidopsis. BMC Plant Biol., 2015. 15: p. 266 [PMID:26530097] Chen X, et al. Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis. Plant Physiol., 2016. 170(4): p. 2136-45 [PMID:26850273] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]