PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.009G315600.2 | ||||||||
Common Name | B456_009G315600, LOC105771006 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 167aa MW: 17846.9 Da PI: 5.731 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.9 | 6.3e-58 | 30 | 127 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdr+lPian+srimkk+lP+n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy+eplk+yl++yr Gorai.009G315600.2 30 VREQDRYLPIANISRIMKKALPSNGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKIYLARYR 120 69***************************************************************************************** PP NF-YB 92 elegekk 98 eleg++k Gorai.009G315600.2 121 ELEGDTK 127 ****975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.1E-55 | 26 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.59E-41 | 33 | 143 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.8E-29 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.0E-21 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.0E-21 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 3.0E-21 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MADGMGGGPT SPAGGSHESG GEHSSPQSTV REQDRYLPIA NISRIMKKAL PSNGKIAKDA 60 KDTVQECVSE FISFITSEAS DKCQKEKRKT INGDDLLWAM ATLGFEDYIE PLKIYLARYR 120 ELEGDTKGSA RGGDGSFKRD AAGALPAQNP QAQGQHMIIP SMQGNE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 1e-48 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-48 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012447852.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Refseq | XP_016685854.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Refseq | XP_016748329.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Refseq | XP_017607611.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Swissprot | Q8VYK4 | 4e-76 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0D2TYB2 | 1e-120 | A0A0D2TYB2_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8JCA1 | 1e-120 | A0A1U8JCA1_GOSHI; nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
STRING | Gorai.009G315600.1 | 1e-117 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 3e-74 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.009G315600.2 |
Entrez Gene | 105771006 |
Publications ? help Back to Top | |||
---|---|---|---|
|