PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.009G288000.12 | ||||||||
Common Name | B456_009G288000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 158aa MW: 18328.2 Da PI: 10.5886 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.2 | 7.8e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyeys+ Gorai.009G288000.12 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN 59 79***********************************************95 PP | |||||||
2 | K-box | 86.3 | 6.2e-29 | 77 | 150 | 4 | 77 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 s+++ ++e +a+++qqe+akL+++i++Lq++ Rhl+G++L+sL++keL+qLe++Le+++++iRskK ++++ +i Gorai.009G288000.12 77 SNTNTVTEINAQYYQQESAKLRQQIQMLQNSSRHLMGDSLSSLTVKELKQLENRLERGITRIRSKKVNIYIPMI 150 5556699***********************************************************98876655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.95 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.56E-42 | 2 | 75 | No hit | No description |
SuperFamily | SSF55455 | 2.22E-33 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.5E-21 | 86 | 147 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.148 | 87 | 157 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYSNN 60 NIRSTIERYK KACSGTSNTN TVTEINAQYY QQESAKLRQQ IQMLQNSSRH LMGDSLSSLT 120 VKELKQLENR LERGITRIRS KKVNIYIPMI HFHFHLI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 1e-21 | 1 | 82 | 1 | 83 | MEF2 CHIMERA |
6bz1_B | 1e-21 | 1 | 82 | 1 | 83 | MEF2 CHIMERA |
6bz1_C | 1e-21 | 1 | 82 | 1 | 83 | MEF2 CHIMERA |
6bz1_D | 1e-21 | 1 | 82 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds (Ref.1). Expressed in endotesta cell layer of developing seeds (PubMed:28369525). {ECO:0000269|PubMed:28369525, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}. | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF190548 | 0.0 | EF190548.1 Gossypium hirsutum MADS-box protein MADS5 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001314587.1 | 4e-98 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_012447615.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Refseq | XP_012447620.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X6 | ||||
Refseq | XP_012447621.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X6 | ||||
Refseq | XP_016686909.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Refseq | XP_016686910.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Refseq | XP_016686911.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 | ||||
Refseq | XP_016686914.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 | ||||
Refseq | XP_016748505.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Refseq | XP_016748506.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Refseq | XP_016748507.1 | 4e-98 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 | ||||
Swissprot | A0A217EJJ0 | 3e-89 | AG11S_VITVI; Agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 4e-89 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A0D2TWV8 | 1e-111 | A0A0D2TWV8_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.009G288000.1 | 1e-96 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.2 | 6e-90 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.009G288000.12 |