PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.009G184800.2 | ||||||||
Common Name | B456_009G184800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 194aa MW: 21613.1 Da PI: 6.4427 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.9 | 8.4e-55 | 24 | 120 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl+vyl++yr Gorai.009G184800.2 24 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANEHCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYR 114 69***************************************************************************************** PP NF-YB 92 elegek 97 elege+ Gorai.009G184800.2 115 ELEGER 120 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.7E-51 | 19 | 125 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.09E-38 | 27 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-26 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.0E-16 | 58 | 76 | No hit | No description |
PRINTS | PR00615 | 4.0E-16 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 4.0E-16 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MNMRMGEANH TNSHSNSDDN ECTVREQDRF MPIANVIRIM RKILPPHAKI SDDAKETIQE 60 CVSEYISFIT GEANEHCQRE QRKTITAEDV LWAMSKLGFD DYIEPLTVYL HRYRELEGER 120 GSIRGEPVVK RVVDYGTLGV AAFAPAFHMG HHHHHGHGFF GSGAMGGYLK DESSAGSSQA 180 AVANGEPYAQ QHK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-62 | 23 | 115 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012447021.1 | 1e-145 | PREDICTED: nuclear transcription factor Y subunit B-6 | ||||
Refseq | XP_016687892.1 | 1e-145 | PREDICTED: nuclear transcription factor Y subunit B-6 | ||||
Swissprot | Q84W66 | 4e-76 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A0B0MVT1 | 1e-143 | A0A0B0MVT1_GOSAR; Nuclear transcription factor Y subunit B-6-like protein | ||||
TrEMBL | A0A0D2TS20 | 1e-144 | A0A0D2TS20_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A0D2UPM6 | 1e-143 | A0A0D2UPM6_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8JC47 | 1e-143 | A0A1U8JC47_GOSHI; nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A2P5QJQ1 | 1e-143 | A0A2P5QJQ1_GOSBA; Uncharacterized protein | ||||
TrEMBL | A0A2P5WW47 | 1e-143 | A0A2P5WW47_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.009G184800.1 | 1e-144 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 9e-70 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.009G184800.2 |