PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.009G143800.7 | ||||||||
Common Name | B456_009G143800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 180aa MW: 20048.7 Da PI: 10.2575 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 101.4 | 8.8e-32 | 25 | 80 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 ep+YVNaKQy++Il+RRq Rakle+++kl +k rkpy+heSRh hA++R+RgsgG+F Gorai.009G143800.7 25 EPIYVNAKQYHAILRRRQYRAKLEAQNKL-IKVRKPYMHESRHLHAIKRARGSGGQF 80 8****************************.*************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 3.2E-35 | 22 | 83 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.263 | 23 | 83 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.4E-26 | 25 | 80 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.3E-23 | 26 | 48 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 28 | 48 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.3E-23 | 57 | 80 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MIHHAHMMAM LPARVPLPLD LKEGEPIYVN AKQYHAILRR RQYRAKLEAQ NKLIKVRKPY 60 MHESRHLHAI KRARGSGGQF LNTKKLQSKS TPTSHGPDMS RSPQLHLSAN ISVTDVHQPE 120 NFKDSGSANS CSDVTSASNS DEIFQQPDFR FYGYPSCHTG EAMPGHAGHI LLSSNSRAN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 5e-21 | 25 | 88 | 3 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012445239.1 | 1e-131 | PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X2 | ||||
Swissprot | Q93ZH2 | 3e-50 | NFYA3_ARATH; Nuclear transcription factor Y subunit A-3 | ||||
TrEMBL | A0A0D2TJS5 | 1e-131 | A0A0D2TJS5_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A0D2ULV8 | 1e-130 | A0A0D2ULV8_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.009G143800.1 | 1e-130 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72830.1 | 1e-52 | nuclear factor Y, subunit A3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.009G143800.7 |
Publications ? help Back to Top | |||
---|---|---|---|
|