PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.009G115000.1 | ||||||||
Common Name | B456_009G115000, LOC105767978 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 204aa MW: 22486.8 Da PI: 8.8657 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.3 | 5.2e-33 | 108 | 164 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+RgsgGrF Gorai.009G115000.1 108 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGSGGRF 164 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.4E-36 | 106 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.039 | 107 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.5E-28 | 109 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 6.7E-24 | 110 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 112 | 132 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 6.7E-24 | 141 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MTSSAHDLSD NNEVDEQKKH SEFSDHSSSP VTGLSPSSIT TPNMPYTTPQ HAVAPAAYPY 60 PDPYYRSIFA PYDAQSYPPQ PYGGQPMVHL QLMGIQQAGV PLPSDAVEEP VFVNAKQYHG 120 ILRRRQSRAK AESENKLAKS RKPYLHESRH LHALRRARGS GGRFLNSKKN ENKQNEAAPS 180 DKSQSNINLN SDKNELASTE GNC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 6e-22 | 107 | 172 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM422775 | 1e-62 | AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012443082.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_012443083.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_012443084.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_012443085.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_016688766.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_016688767.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q84JP1 | 4e-70 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A0D2Q4N4 | 1e-148 | A0A0D2Q4N4_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8JEL5 | 1e-148 | A0A1U8JEL5_GOSHI; nuclear transcription factor Y subunit A-7-like | ||||
TrEMBL | A0A2P5QSQ2 | 1e-148 | A0A2P5QSQ2_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.009G115000.1 | 1e-149 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4168 | 27 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-54 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.009G115000.1 |
Entrez Gene | 105767978 |
Publications ? help Back to Top | |||
---|---|---|---|
|