 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Gorai.009G030900.2 |
| Common Name | B456_009G030900 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
| Family |
MYB_related |
| Protein Properties |
Length: 193aa MW: 21096.1 Da PI: 10.3931 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Gorai.009G030900.2 | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 43.2 | 9.1e-14 | 108 | 152 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE+ ++ + ++lG+g+W+ I++ + ++Rt+ q+ s+ qky
Gorai.009G030900.2 108 PWTEEEHRVFLVGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKY 152
8*******************************************9 PP
|
| Sequence ? help Back to Top |
| Protein Sequence Length: 193 aa
Download sequence Send
to blast |
MGRKCSHCGN IGHNSRTCTT FRGSSVVGGL RLFGVQLGIS SSSSDSLKKS ISMDCLSSSA 60
SPSSPSPSSS LSSPRISMDE LSDKTTSNIG YLSDGLMAPS HERKKGVPWT EEEHRVFLVG 120
LEKLGKGDWR GISKNFVTTR TPTQVASHAQ KYFLRQSTLN KKKRRSSLFD MVYTIYNYII 180
IISIVMVLQF TS*
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Accumulates during leaf expansion. First observed at the tip of the leaves 12 days after sowing (DAS). At 14 DAS, expressed throughout the leaf blade to fade out thereafter in a basipetal manner. In mature leaves, detected in vascular tissue, especially in companion cells (PubMed:24806884). Accumulates to higher levels in old rosette leaves than in young rosette and cauline leaves (PubMed:25920996). {ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}. |
| Uniprot | TISSUE SPECIFICITY: Expressed ubiquitously, except in hypocotyls, root tips and lateral root primordia. {ECO:0000269|PubMed:25920996}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
| UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
| UniProt | INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | JX622827 | 2e-49 | JX622827.1 Gossypium hirsutum clone NBRI_GE69725 microsatellite sequence. |
| Publications
? help Back to Top |
- Rice Chromosome 10 Sequencing Consortium
In-depth view of structure, activity, and evolution of rice chromosome 10.
Science, 2003. 300(5625): p. 1566-9
[PMID:12791992] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Su CF, et al.
A novel MYBS3-dependent pathway confers cold tolerance in rice.
Plant Physiol., 2010. 153(1): p. 145-58
[PMID:20130099] - Paterson AH, et al.
Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
Nature, 2012. 492(7429): p. 423-7
[PMID:23257886] - Liu C,Wang B,Li Z,Peng Z,Zhang J
TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
Plant Physiol., 2018. 176(1): p. 742-756
[PMID:29122985]
|
