PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G332400.1
Common NameB456_007G332400, LOC105761350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family STAT
Protein Properties Length: 709aa    MW: 79641.1 Da    PI: 5.2969
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G332400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT179.25.8e-562223431122
                STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipk 91 
                         ldv+lln++gqpv+k++evvasLlya + l+vek++d+e+pLL+s+dG+ef+s drp+kl +Grasfklkis+Lsskcdnr f+ikf + k
  Gorai.007G332400.1 222 LDVLLLNTFGQPVNKELEVVASLLYAHNWLPVEKTNDEEPPLLASCDGIEFASCDRPCKLSKGRASFKLKISKLSSKCDNRQFCIKFGVSK 312
                         89***************************************************************************************** PP

                STAT  92 lkkypfleavskpirCisrsrntrsssltkk 122
                         l+ y+fle +s +irCisr+r+ r+s+ ++k
  Gorai.007G332400.1 313 LEGYRFLEDFSPSIRCISRNRTPRTSTIVWK 343
                         *************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2004.0E-65177IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498991.85E-69171IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133851.6E-69177No hitNo description
CDDcd103382.31E-55597708No hitNo description
Gene3DG3DSA:3.30.505.107.0E-7600682IPR000980SH2 domain
SuperFamilySSF555502.67E-8604667IPR000980SH2 domain
PROSITE profilePS5000110.093608708IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MGENNQIIGE DDYILLKDFK VETEVDEEKG FILCFWVYIF NSNAFPSTIL KQVYAETNSS  60
PPLLVLDEKT LMIFPLTCLL NEALGSGNTD LPSEVPKVSA EIEHPQNNWI HVGYEVSSDF  120
VRLYINGEIA GELHLSSLSN DNSMPNGSRK RTLIGITGDS NLQGFIHDAK VLLSTLSIKE  180
QYVKDPPLRL SIDESSISDI EEDNGFWNIV GGKASCRRIF SLDVLLLNTF GQPVNKELEV  240
VASLLYAHNW LPVEKTNDEE PPLLASCDGI EFASCDRPCK LSKGRASFKL KISKLSSKCD  300
NRQFCIKFGV SKLEGYRFLE DFSPSIRCIS RNRTPRTSTI VWKKISAVHP VNGSQPFGLD  360
DSSCEPKHNI VHEAKLSPTS KRVRLGEAKI SAVDQHSEEC NSLASKQNQV ENGFGSRLEA  420
RPENFEEMNT SLSDSESTGA RDSALKSVSS RGHSVPDVTI FRYCLGGLTD RSLLLKEIAT  480
TVSDEEISGF AEQVSLYSGC SHHRHQIKMA KRLIDEGTVA WNLISQNNIQ VQWESAVFEI  540
EEQFMKIASC SSRSLTQQDF ELLRKIAGCQ EYMAQENFEK MWCWLYPVAY TLSSDWVNEM  600
WNSTSPKWIE GFITKEEAEL SLQGSRGLQE PGTFILRFPT SRSWPHPDAG SLVVTYVGTD  660
YCLHHKLLSI DNVYSSGVRE KNVKVKPLQD MLLEEPELSR LGRIMRRH*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:15073273}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434593.10.0PREDICTED: uncharacterized protein LOC105761350 isoform X1
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A0D2R3E90.0A0A0D2R3E9_GOSRA; Uncharacterized protein
STRINGGorai.007G332400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]