PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.007G298300.1 | ||||||||
Common Name | B456_007G298300, LOC105801620 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 138aa MW: 15294.2 Da PI: 4.8035 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 143.9 | 3.9e-45 | 4 | 94 | 3 | 93 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 eq+ flPianv+rimk++lP ak+sk+aket+qecv+efisfvtseasdkc++ rkti gdd++wal+ +G+++y++++ yl+kyr + Gorai.007G298300.1 4 EQNPFLPIANVGRIMKQILPPSAKVSKEAKETMQECVTEFISFVTSEASDKCRKGSRKTICGDDICWALGAVGLDNYAQAMIRYLHKYRVA 94 89***************************************************************************************76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-44 | 3 | 125 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.19E-35 | 5 | 121 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.5E-25 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.1E-12 | 36 | 54 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.1E-12 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 5.1E-12 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MGDEQNPFLP IANVGRIMKQ ILPPSAKVSK EAKETMQECV TEFISFVTSE ASDKCRKGSR 60 KTICGDDICW ALGAVGLDNY AQAMIRYLHK YRVAALNQQK ATTSSFEDKD EESDRSGEPS 120 HQEDETTTPQ VVMNIFI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-36 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-36 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012488295.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 2e-44 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0D2PGT9 | 3e-99 | A0A0D2PGT9_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.007G298300.1 | 1e-100 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 9e-47 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.007G298300.1 |
Entrez Gene | 105801620 |
Publications ? help Back to Top | |||
---|---|---|---|
|