PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.007G147300.1 | ||||||||
Common Name | B456_007G147300, LOC105803214 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 255aa MW: 29341 Da PI: 6.5705 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.3 | 4.4e-51 | 10 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrF P+deelv++yL kk++++++ ++ e+d++++ePw+Lp+++k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd+ Gorai.007G147300.1 10 LPPGFRFYPSDEELVCHYLYKKIANEQVLK-GTLVEIDLHTCEPWQLPEAAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRM 99 79************************9655.78***************88888999*********************************** PP NAM 92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 vl+ ++e+vg++ktLvfy++rap+g+kt W+mhe+rl Gorai.007G147300.1 100 VLDPtTEEVVGMRKTLVFYRNRAPNGVKTGWIMHEFRL 137 ***977888***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.75E-61 | 8 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.442 | 10 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.8E-28 | 11 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 255 aa Download sequence Send to blast |
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KIANEQVLKG TLVEIDLHTC EPWQLPEAAK 60 LNANEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRMV LDPTTEEVVG MRKTLVFYRN 120 RAPNGVKTGW IMHEFRLHTP HLPPKEEWVL CRVFHKSKEE NSAKLSSPMM LETSSTHHAH 180 ETAYQHISSL STTTPTYQSH AQCLLNLLQY NSHQENNSNE VSSKVDDGYE FLWDMEENSL 240 ECSWGGFQLG GHEI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-48 | 9 | 156 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-48 | 9 | 156 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-48 | 9 | 156 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-48 | 9 | 156 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
3swm_B | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
3swm_C | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
3swm_D | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
3swp_A | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
3swp_B | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
3swp_C | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
3swp_D | 4e-48 | 9 | 156 | 19 | 168 | NAC domain-containing protein 19 |
4dul_A | 3e-48 | 9 | 156 | 16 | 165 | NAC domain-containing protein 19 |
4dul_B | 3e-48 | 9 | 156 | 16 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC847217 | 0.0 | KC847217.1 Gossypium hirsutum NAC domain protein NAC40 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001314147.1 | 0.0 | protein CUP-SHAPED COTYLEDON 3-like | ||||
Refseq | XP_012490707.1 | 0.0 | PREDICTED: protein CUP-SHAPED COTYLEDON 3-like | ||||
Swissprot | Q84TE6 | 3e-62 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A0D2SJY3 | 0.0 | A0A0D2SJY3_GOSRA; Uncharacterized protein | ||||
TrEMBL | W6J8X8 | 0.0 | W6J8X8_GOSHI; NAC domain protein NAC40 | ||||
STRING | Gorai.007G147300.1 | 0.0 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3436 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28530.1 | 5e-91 | NAC domain containing protein 74 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.007G147300.1 |
Entrez Gene | 105803214 |