PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.007G009800.2

Common Name

B456_007G009800, LOC105801767

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MIKC_MADS

Protein Properties

Length: 185aa MW: 21552.7 Da PI: 9.8622

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.007G009800.2	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	93.4	1.1e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+EL vLCdaevaviifs++gklye+ss Gorai.007G009800.2 9 KRIENATSRQVTFSKRRNGLLKKAYELYVLCDAEVAVIIFSNKGKLYEFSS 59 79***********************************************96 PP
2	K-box	59.5	1.4e-20	79	162	5	88
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 s++ + e+ ++l+ e++++ k+ie L+ ++R++lG++L+s+s+ eLq++e+qLe+sl++iR++K l++eqi +l+ k++ + Gorai.007G009800.2 79 SNTPQIERYRQQLRLEAENMAKKIEFLEVSKRRMLGQNLGSCSIDELQEVENQLERSLRNIRARKGYLFKEQILQLKAKNNGTT 162 444477788899*****************************************************************9987554 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.029	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.9E-39	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-32	3	75	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-31	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.22E-41	3	76	No hit	No description
Pfam	PF00319	1.2E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-31	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	12.451	88	184	IPR002487	Transcription factor, K-box
Pfam	PF01486	9.8E-20	88	160	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009838	Biological Process	abscission
GO:0009909	Biological Process	regulation of flower development
GO:0010150	Biological Process	leaf senescence
GO:0080187	Biological Process	floral organ senescence
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MVRGKIQIKR IENATSRQVT FSKRRNGLLK KAYELYVLCD AEVAVIIFSN KGKLYEFSSC 60 DNMQNTIERY RQYKKDVQSN TPQIERYRQQ LRLEAENMAK KIEFLEVSKR RMLGQNLGSC 120 SIDELQEVEN QLERSLRNIR ARKGYLFKEQ ILQLKAKNNG TTCSQQNAEV ETELFLGLPE 180 NRCS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	7e-20	1	81	1	80	MEF2 CHIMERA
6byy_B	7e-20	1	81	1	80	MEF2 CHIMERA
6byy_C	7e-20	1	81	1	80	MEF2 CHIMERA
6byy_D	7e-20	1	81	1	80	MEF2 CHIMERA
6bz1_A	7e-20	1	84	1	83	MEF2 CHIMERA
6bz1_B	7e-20	1	84	1	83	MEF2 CHIMERA
6bz1_C	7e-20	1	84	1	83	MEF2 CHIMERA
6bz1_D	7e-20	1	84	1	83	MEF2 CHIMERA
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269\|PubMed:21609362}.
Uniprot	TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269\|PubMed:18162590, ECO:0000269\|PubMed:21689171}.

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269\|PubMed:21609362, ECO:0000269\|PubMed:21689171}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00576	DAP	Transfer from AT5G62165	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HM236430	0.0	HM236430.1 Gossypium hirsutum MADS15 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012488493.1	1e-131	PREDICTED: MADS-box protein SOC1-like isoform X2
Swissprot	Q9FIS1	2e-70	AGL42_ARATH; MADS-box protein AGL42
TrEMBL	A0A0D2SC39	1e-130	A0A0D2SC39_GOSRA; Uncharacterized protein
STRING	Gorai.007G009800.1	1e-127	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.3	9e-73	AGAMOUS-like 42

Link Out ? help Back to Top
Phytozome	Gorai.007G009800.2
Entrez Gene	105801767

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886]