PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.006G220700.1 | ||||||||
Common Name | B456_006G220700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 68aa MW: 8095.38 Da PI: 10.7358 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.7 | 1.6e-10 | 4 | 59 | 4 | 59 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 k+++r +NR A rsR+RKk++++ e k+ Le+e ++L l+ + e ++l Gorai.006G220700.1 4 AKKQKRQLRNRDAVVRSRERKKMYVKDFEMKSRYLEGECRRLSHVLQCFSAENQAL 59 69****************************************99888777777765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 0.0044 | 1 | 65 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.898 | 3 | 60 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.5E-12 | 4 | 60 | No hit | No description |
Pfam | PF00170 | 6.5E-10 | 4 | 59 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.56E-11 | 5 | 60 | No hit | No description |
CDD | cd14704 | 1.30E-11 | 6 | 57 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
DPIAKKQKRQ LRNRDAVVRS RERKKMYVKD FEMKSRYLEG ECRRLSHVLQ CFSAENQALQ 60 IFFFSSP* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017606263.1 | 5e-30 | PREDICTED: bZIP transcription factor 60-like | ||||
Refseq | XP_022765478.1 | 4e-30 | bZIP transcription factor 60-like isoform X2 | ||||
Swissprot | Q69XV0 | 1e-23 | BZP50_ORYSJ; bZIP transcription factor 50 | ||||
TrEMBL | A0A0D2QES7 | 2e-41 | A0A0D2QES7_GOSRA; Uncharacterized protein (Fragment) | ||||
STRING | Gorai.006G220700.1 | 3e-42 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4634 | 28 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G42990.1 | 5e-14 | basic region/leucine zipper motif 60 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.006G220700.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|