PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.005G162600.1

Common Name

B456_005G162600, LOC105794444

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 217aa MW: 24465.6 Da PI: 8.7503

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.005G162600.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.6	5.1e-17	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ede+l+++++++G g+W+t ++ g+ R++k+c++rw +yl Gorai.005G162600.1 13 KGAWSKQEDEKLINYIRLHGEGCWRTLPQAAGLLRCGKSCRLRWINYL 60 79****************************99**********97 PP
2	Myb_DNA-binding	57.9	2.4e-18	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l Gorai.005G162600.1 66 RGNFTEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.4E-23	4	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.528	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	1.42E-28	11	107	IPR009057	Homeodomain-like
SMART	SM00717	4.3E-13	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	4.4E-15	13	60	IPR001005	SANT/Myb domain
CDD	cd00167	1.39E-10	15	60	No hit	No description
PROSITE profile	PS51294	28.191	61	115	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.4E-27	64	116	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-17	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	6.6E-17	66	111	IPR001005	SANT/Myb domain
CDD	cd00167	5.05E-13	68	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 217 aa Download sequence Send to blast
MRKPCCDKQD TNKGAWSKQE DEKLINYIRL HGEGCWRTLP QAAGLLRCGK SCRLRWINYL 60 RPDLKRGNFT EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLINMGI 120 DPNNHRLITH NHLPRPHDSN SGASIISPAS KVPVTDNSNI HPPEKSRGDN DQVSDAASSL 180 EDHQLPDLNL DLTISVSAST VDKLKMIDEK ARNSPT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-28	10	115	4	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012479075.1	1e-158	PREDICTED: transcription repressor MYB4-like
Swissprot	Q9SZP1	3e-80	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A0D2RG56	1e-157	A0A0D2RG56_GOSRA; Uncharacterized protein
STRING	Gorai.005G162600.1	1e-158	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	1e-82	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Gorai.005G162600.1
Entrez Gene	105794444

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]