PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G146700.1
Common NameB456_005G146700, LOC105796168
Organism
Gossypium raimondii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family YABBY
Protein Properties Length: 178aa    MW: 19459.1 Da    PI: 8.4948
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G146700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY143.52.2e-4491551163
               YABBY   1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekees 91 
                         +d++ +se++Cyv+CnfCnt+lav +P + l+++vtv+CGhC++l  ++ +   q +         l ++   +l++   +++        
  Gorai.005G146700.1   9 MDLVPQSEHLCYVRCNFCNTVLAVGIPCKRLLETVTVKCGHCSNLSFLSTRPPLQGQ--------CLDPQTSLTLQSFCGDFR-------- 83 
                         578899*************************************98553333322222........222223333333322222........ PP

               YABBY  92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                         + t+ +s + s++++ ++p++p v++PPek+ r Psaynrf+keeiqrika+nP+i hreafsaaaknWa +
  Gorai.005G146700.1  84 KGTQFPSPSSSTSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY 155
                         2233333334667778899***************************************************76 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046906.0E-5314155IPR006780YABBY protein
SuperFamilySSF470957.59E-999153IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.4E-5109154IPR009071High mobility group box domain
CDDcd013903.16E-6116152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MNLEDKVGMD LVPQSEHLCY VRCNFCNTVL AVGIPCKRLL ETVTVKCGHC SNLSFLSTRP  60
PLQGQCLDPQ TSLTLQSFCG DFRKGTQFPS PSSSTSSEPS SPKAPFVVKP PEKKHRLPSA  120
YNRFMKEEIQ RIKAANPEIP HREAFSAAAK NWARYIPNSP AASSVCGSSS NEQNDNV*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In carpels, expression starts when the gynoecial primordia becomes distinct. First expressed in the lateral region of each carpel. Later resolves into two distinct domains, epidermal and internal. In epidermal tissues, mostly localized on the outer surface, successively from the base to the tip of the gynoecium and finally confined to the valve region before disappearing during last flowering stages. In internal tissues, first confined to four discrete zones adjacent to the future placental tissue occupying the full length of the elongating cylinder, declining from the apical regions and disappearing after the ovule primordia arise. Before nectaries initiation, expression occupies a ring of receptacle cells between the stamen and sepal primordia, from where nectaries will develop. Strongly expressed in nectaries until latest flowering stages. {ECO:0000269|PubMed:10225998}.
UniprotTISSUE SPECIFICITY: Restricted to flowers, mostly in carpels and nectaries. Expressed at low levels in sepal primordia (buds), sepal receptacle and developing petal. Not detected in placental tissues, septum, stigma and ovules. {ECO:0000269|PubMed:10225998}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8548040.0AY854804.1 Gossypium hirsutum isolate 1 CRABS CLAW mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481221.11e-129PREDICTED: protein CRABS CLAW isoform X2
RefseqXP_016667798.11e-129PREDICTED: protein CRABS CLAW-like isoform X2
RefseqXP_016728817.11e-129PREDICTED: protein CRABS CLAW-like isoform X2
RefseqXP_017648271.11e-129PREDICTED: protein CRABS CLAW
SwissprotQ8L9256e-70CRC_ARATH; Protein CRABS CLAW
TrEMBLA0A0D2NCW11e-128A0A0D2NCW1_GOSRA; Uncharacterized protein
TrEMBLA0A1U8MPS51e-128A0A1U8MPS5_GOSHI; protein CRABS CLAW-like isoform X2
STRINGGorai.005G146700.11e-129(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97252835
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.12e-69YABBY family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C
    The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development.
    Ann. Bot., 2014. 114(7): p. 1535-44
    [PMID:24989787]
  3. Pfannebecker KC,Lange M,Rupp O,Becker A
    Seed Plant-Specific Gene Lineages Involved in Carpel Development.
    Mol. Biol. Evol., 2017. 34(4): p. 925-942
    [PMID:28087776]
  4. Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T
    Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation.
    Nat Commun, 2017. 8(1): p. 1125
    [PMID:29066759]
  5. Yamaguchi N, et al.
    Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy.
    Nat Commun, 2018. 9(1): p. 5290
    [PMID:30538233]