PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.005G059500.2 | ||||||||
Common Name | B456_005G059500, LOC105796827 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 152aa MW: 17067.1 Da PI: 5.0575 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 167 | 2.4e-52 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 +eqd++lPianv+rimk++lP nakisk+aket+qecvsefisfvt+eas+kc++e+rkt+ngdd++walatlGf++y+ plk yl k+re Gorai.005G059500.2 19 KEQDHLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASEKCRKERRKTVNGDDICWALATLGFDNYAVPLKRYLYKFRE 109 79***************************************************************************************** PP NF-YB 93 legek 97 +eg+k Gorai.005G059500.2 110 FEGDK 114 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.8E-52 | 17 | 140 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.08E-38 | 21 | 143 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.3E-27 | 25 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-17 | 52 | 70 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.8E-17 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 1.8E-17 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MAENIGTSND GGGDGYGFKE QDHLLPIANV GRIMKQILPP NAKISKEAKE TMQECVSEFI 60 SFVTGEASEK CRKERRKTVN GDDICWALAT LGFDNYAVPL KRYLYKFREF EGDKAANQVK 120 VSISNSKDDD DDEAQKQQQQ SPLMFQHDWK P* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-43 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-43 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX615976 | 1e-123 | JX615976.1 Gossypium hirsutum clone NBRI_GE60289 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012482108.1 | 1e-111 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 5e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0D2N8E2 | 1e-110 | A0A0D2N8E2_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.005G059500.1 | 1e-110 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-56 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.005G059500.2 |
Entrez Gene | 105796827 |
Publications ? help Back to Top | |||
---|---|---|---|
|