PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.004G075100.2 | ||||||||
Common Name | B456_004G075100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 139aa MW: 16112.3 Da PI: 7.7584 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 133.4 | 8.2e-42 | 2 | 86 | 34 | 118 |
CG-1 34 pksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118 pksg+++L++rk++r+frkDGy+w +kkdgkt++E+he+LKvg e +++yYah+e+n+tf rrcywlL+++le++vlvhy+e+k Gorai.004G075100.2 2 PKSGTIVLFDRKMLRNFRKDGYNWENKKDGKTIKEAHEHLKVGDKERIHVYYAHGEDNSTFVRRCYWLLDKSLEQMVLVHYRETK 86 9*********************************************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01076 | 7.7E-37 | 1 | 86 | IPR005559 | CG-1 DNA-binding domain |
PROSITE profile | PS51437 | 57.563 | 1 | 91 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 9.0E-37 | 2 | 84 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MPKSGTIVLF DRKMLRNFRK DGYNWENKKD GKTIKEAHEH LKVGDKERIH VYYAHGEDNS 60 TFVRRCYWLL DKSLEQMVLV HYRETKEVSL ATHSNSSLLT DQSTPLLVTK EFDSGIANTY 120 SEGERSLGDV EIFQRLIM* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, pollen, top of sepals and siliques. {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:14581622). Binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in response to cold. Contributes together with CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:14581622, ECO:0000269|PubMed:28351986, ECO:0000305|PubMed:11925432}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat shock, UVB, wounding, abscisic acid, H(2)O(2) and salicylic acid. {ECO:0000269|PubMed:12218065}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012473836.1 | 2e-87 | PREDICTED: calmodulin-binding transcription activator 5-like isoform X3 | ||||
Swissprot | O23463 | 2e-47 | CMTA5_ARATH; Calmodulin-binding transcription activator 5 | ||||
TrEMBL | A0A0D2R0M8 | 1e-98 | A0A0D2R0M8_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.005G065700.1 | 1e-68 | (Gossypium raimondii) | ||||
STRING | Gorai.012G074000.1 | 3e-69 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16150.1 | 6e-50 | calmodulin binding;transcription regulators |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.004G075100.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|