PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G075100.2
Common NameB456_004G075100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CAMTA
Protein Properties Length: 139aa    MW: 16112.3 Da    PI: 7.7584
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G075100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1133.48.2e-4228634118
                CG-1  34 pksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                         pksg+++L++rk++r+frkDGy+w +kkdgkt++E+he+LKvg  e +++yYah+e+n+tf rrcywlL+++le++vlvhy+e+k
  Gorai.004G075100.2   2 PKSGTIVLFDRKMLRNFRKDGYNWENKKDGKTIKEAHEHLKVGDKERIHVYYAHGEDNSTFVRRCYWLLDKSLEQMVLVHYRETK 86 
                         9*********************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010767.7E-37186IPR005559CG-1 DNA-binding domain
PROSITE profilePS5143757.563191IPR005559CG-1 DNA-binding domain
PfamPF038599.0E-37284IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MPKSGTIVLF DRKMLRNFRK DGYNWENKKD GKTIKEAHEH LKVGDKERIH VYYAHGEDNS  60
TFVRRCYWLL DKSLEQMVLV HYRETKEVSL ATHSNSSLLT DQSTPLLVTK EFDSGIANTY  120
SEGERSLGDV EIFQRLIM*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, pollen, top of sepals and siliques. {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:14581622). Binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in response to cold. Contributes together with CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:14581622, ECO:0000269|PubMed:28351986, ECO:0000305|PubMed:11925432}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, wounding, abscisic acid, H(2)O(2) and salicylic acid. {ECO:0000269|PubMed:12218065}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473836.12e-87PREDICTED: calmodulin-binding transcription activator 5-like isoform X3
SwissprotO234632e-47CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLA0A0D2R0M81e-98A0A0D2R0M8_GOSRA; Uncharacterized protein
STRINGGorai.005G065700.11e-68(Gossypium raimondii)
STRINGGorai.012G074000.13e-69(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.16e-50calmodulin binding;transcription regulators
Publications ? help Back to Top
  1. Ye J, et al.
    Arabidopsis formin3 directs the formation of actin cables and polarized growth in pollen tubes.
    Plant Cell, 2009. 21(12): p. 3868-84
    [PMID:20023198]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  4. Lan Y,Liu X,Fu Y,Huang S
    Arabidopsis class I formins control membrane-originated actin polymerization at pollen tube tips.
    PLoS Genet., 2018. 14(11): p. e1007789
    [PMID:30418966]