PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.004G023900.1 | ||||||||
Common Name | B456_004G023900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 121aa MW: 12897.9 Da PI: 9.0761 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 67.4 | 3.3e-21 | 43 | 103 | 1 | 61 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamssl 61 +C aCk+lrr+Ca++Cvlapyfp ++p+kfa++h++FGasn++k+l+ +++ e+ ++s+ Gorai.004G023900.1 43 PCVACKILRRRCADKCVLAPYFPPTEPAKFAIAHRVFGASNIIKFLQVPSTSPAENQLTSV 103 7*********************************************987666666665555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 15.425 | 42 | 120 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.5E-20 | 43 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MEYSEPIPTP TISSSPSLSP NSLISSNSPP SPPLSPPLVV ISPCVACKIL RRRCADKCVL 60 APYFPPTEPA KFAIAHRVFG ASNIIKFLQV PSTSPAENQL TSVVKKKPHC TDSLNQTTQQ 120 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-16 | 42 | 88 | 10 | 56 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-16 | 42 | 88 | 10 | 56 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX616907 | 2e-45 | JX616907.1 Gossypium hirsutum clone NBRI_GE61864 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012462233.1 | 3e-35 | PREDICTED: LOB domain-containing protein 1-like | ||||
TrEMBL | A0A0D2MSI3 | 1e-78 | A0A0D2MSI3_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.004G023900.1 | 2e-79 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM20654 | 4 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 2e-28 | LOB domain-containing protein 11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.004G023900.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|