PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.003G011500.2 | ||||||||
Common Name | B456_003G011500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 166aa MW: 19338.6 Da PI: 11.0228 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91 | 5.7e-29 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ien +nrqvt+skRrng++KKA+EL vLCda+v++i+fsstgk++e+ Gorai.003G011500.2 9 KKIENATNRQVTYSKRRNGLFKKAQELTVLCDAKVSLIMFSSTGKFHEFL 58 68**********************************************96 PP | |||||||
2 | K-box | 72.1 | 1.7e-24 | 71 | 141 | 1 | 71 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne 71 yqk++g +l+++++e++++++++Lk+ +++L+re+R+++G dL++L++keLq Le ++++sl iR++K Gorai.003G011500.2 71 YQKATGIDLWNSHYERMDENYRRLKEINKKLRREIRQRMGGDLNELNIKELQALEAKMDSSLLAIRERKPP 141 8999*****************************************************************53 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.674 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-37 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.26E-39 | 2 | 80 | No hit | No description |
PRINTS | PR00404 | 2.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 9.2E-15 | 82 | 146 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.099 | 84 | 165 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MGRGKIEIKK IENATNRQVT YSKRRNGLFK KAQELTVLCD AKVSLIMFSS TGKFHEFLSP 60 NISTKGVFDL YQKATGIDLW NSHYERMDEN YRRLKEINKK LRREIRQRMG GDLNELNIKE 120 LQALEAKMDS SLLAIRERKP PLKRLLTMFL GTMSSKLKQT NTRRR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 8e-16 | 1 | 62 | 1 | 62 | MEF2C |
5f28_B | 8e-16 | 1 | 62 | 1 | 62 | MEF2C |
5f28_C | 8e-16 | 1 | 62 | 1 | 62 | MEF2C |
5f28_D | 8e-16 | 1 | 62 | 1 | 62 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed during flower development in stamens, petals and carpels (PubMed:17920788). Expressed in fruits and seeds (PubMed:17920788). {ECO:0000269|PubMed:17920788}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC155646 | 0.0 | KC155646.1 Gossypium hirsutum MADS box protein MADS51 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012469369.1 | 2e-97 | PREDICTED: floral homeotic protein PMADS 1-like isoform X1 | ||||
Refseq | XP_012469371.1 | 1e-97 | PREDICTED: floral homeotic protein PMADS 1-like isoform X2 | ||||
Swissprot | Q003J2 | 1e-74 | TM6_VITVI; Agamous-like MADS-box protein TM6 | ||||
TrEMBL | A0A0D2QE54 | 1e-117 | A0A0D2QE54_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.003G011500.1 | 6e-97 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 2e-60 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.003G011500.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|