PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.003G007000.1

Common Name

B456_003G007000, LOC105787448

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

bZIP

Protein Properties

Length: 228aa MW: 25091 Da PI: 10.7221

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.003G007000.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.5	3.3e-14	158	207	5	54
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 +r +r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +L+ + e+l+ Gorai.003G007000.1 158 RRHKRMIKNRESAARSRARKQAYTNELELEVAHLMEENAKLRRQQEQLRV 207 699***************************************99999975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.4E-11	149	218	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.3	156	206	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.1E-12	158	206	IPR004827	Basic-leucine zipper domain
CDD	cd14707	6.81E-30	158	212	No hit	No description
SuperFamily	SSF57959	4.19E-11	158	206	No hit	No description
Gene3D	G3DSA:1.20.5.170	5.7E-14	158	207	No hit	No description
PROSITE pattern	PS00036	0	161	176	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:2000028	Biological Process	regulation of photoperiodism, flowering
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0043621	Molecular Function	protein self-association

Sequence ? help Back to Top
Protein Sequence Length: 228 aa Download sequence Send to blast
MLSPSNKPQI TPLKPSSPSP PHRPKTMEEV WNDITLASLH DHHSSSSSSR EPFSSSPHLI 60 LQDFLAARSD PPPPQQQTNG GGDTNTMLYG SPLPPPATVL SLNSGPGFDF LDNPRLQSSP 120 ISTLPTFNSP FEALASSTTL ATFGKKRTQD SDNSSGNRRH KRMIKNRESA ARSRARKQAY 180 TNELELEVAH LMEENAKLRR QQEQLRVAAT AQLSRNRMLQ RTSTAPF*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980, ECO:0000269\|PubMed:25661797}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX615437	1e-179	JX615437.1 Gossypium hirsutum clone NBRI_GE59423 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012469288.1	1e-164	PREDICTED: protein FD-like
Swissprot	Q84JK2	2e-69	FD_ARATH; Protein FD
TrEMBL	A0A0D2QL66	1e-162	A0A0D2QL66_GOSRA; Uncharacterized protein
STRING	Gorai.003G007000.1	1e-163	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1934	27	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	8e-61	bZIP family protein

Link Out ? help Back to Top
Phytozome	Gorai.003G007000.1
Entrez Gene	105787448

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]