PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.003G003200.1 | ||||||||
Common Name | B456_003G003200, LOC105787407 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 174aa MW: 20164.5 Da PI: 8.6776 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 122.8 | 1.5e-38 | 61 | 136 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+++C adl++ak+yhrrhkvCe h+k + vlv+g++qrfCqqCsrfhe+s+fD +krsCr+rLa+hn rrrk Gorai.003G003200.1 61 CQADECGADLKDAKQYHRRHKVCEPHAKDAFVLVKGIRQRFCQQCSRFHEISKFDGTKRSCRDRLAGHNLRRRKVV 136 *************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 29.299 | 58 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.08E-34 | 61 | 137 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.9E-31 | 61 | 134 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 2.5E-31 | 61 | 122 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MEMAKRACKT TVNWVDDEEE EEQREERMVK IRVVPRERYE RMNTFIHYSN SAAISGGGGG 60 CQADECGADL KDAKQYHRRH KVCEPHAKDA FVLVKGIRQR FCQQCSRFHE ISKFDGTKRS 120 CRDRLAGHNL RRRKVVQSDQ EAENDNSNNK NKASYGKGTD TPMLQQWYQE FTN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-31 | 55 | 134 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ622320 | 0.0 | KJ622320.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL12) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012469239.1 | 1e-129 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q6Z461 | 7e-33 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
TrEMBL | A0A0D2REE1 | 1e-128 | A0A0D2REE1_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.003G003200.1 | 1e-128 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM22067 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 4e-33 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.003G003200.1 |
Entrez Gene | 105787407 |
Publications ? help Back to Top | |||
---|---|---|---|
|