PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G122200.1
Common NameB456_002G122200, LOC105784201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 181aa    MW: 19870.7 Da    PI: 10.3771
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G122200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.72.9e-14110159352
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                         ++ r +rk+kNR +A rsR+RK+a++ eLe +v+ L +eN +L+ + ++l
  Gorai.002G122200.1 110 DDPRHKRKIKNRKSAARSRARKQAYTNELELEVARLLEENVKLRRQQDKL 159
                         6889****************************************877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-10108172IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898110159IPR004827Basic-leucine zipper domain
CDDcd147079.79E-24113165No hitNo description
Gene3DG3DSA:1.20.5.1702.4E-12113160No hitNo description
SuperFamilySSF579594.85E-10113160No hitNo description
PfamPF001708.9E-12113159IPR004827Basic-leucine zipper domain
PROSITE patternPS000360115130IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEEVWGDIGL ASLNDHPAVT PTANPPSFPS VILQDFLAIP INKEMPPTAR SGCGTSLTEE  60
TTLFGSLPPT PATLFTLNAR SIASVAVKAP APSFPSSCRK KGQENEENSD DPRHKRKIKN  120
RKSAARSRAR KQAYTNELEL EVARLLEENV KLRRQQDKLL ASPRQIPKRN TLCRTLTAPF  180
*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269|PubMed:16099979, ECO:0000269|PubMed:16099980, ECO:0000269|PubMed:25661797}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for the transition to flowering promoted by FT. {ECO:0000269|PubMed:16099979, ECO:0000269|PubMed:16099980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465462.11e-129PREDICTED: protein FD-like
RefseqXP_012465469.11e-129PREDICTED: protein FD-like
RefseqXP_012465476.11e-129PREDICTED: protein FD-like
SwissprotQ84JK27e-39FD_ARATH; Protein FD
TrEMBLA0A0D2Q4X71e-128A0A0D2Q4X7_GOSRA; Uncharacterized protein
STRINGGorai.002G122200.11e-129(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19342772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.15e-19bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ho WW,Weigel D
    Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T.
    Plant Cell, 2014. 26(2): p. 552-64
    [PMID:24532592]
  3. Ji H, et al.
    Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 237
    [PMID:25201173]
  4. Li L, et al.
    Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 381
    [PMID:25547226]
  5. Sussmilch FC, et al.
    Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development.
    Plant Cell, 2015. 27(4): p. 1046-60
    [PMID:25804541]
  6. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  7. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  8. Kawamoto N,Endo M,Araki T
    Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering.
    Plant Signal Behav, 2015. 10(12): p. e1086856
    [PMID:26440648]
  9. Zhang L,Yu H,Lin S,Gao Y
    Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis.
    Front Plant Sci, 2016. 7: p. 8
    [PMID:26834775]
  10. Hou CJ,Yang CH
    Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1.
    Plant Mol. Biol., 2016. 91(4-5): p. 563-79
    [PMID:27216814]
  11. Jung JH,Lee HJ,Ryu JY,Park CM
    SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering.
    Mol Plant, 2016. 9(12): p. 1647-1659
    [PMID:27815142]
  12. Jang S,Li HY,Kuo ML
    Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets.
    Sci Rep, 2017. 7: p. 44477
    [PMID:28290557]