PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.001G222300.1 | ||||||||
Common Name | B456_001G222300, LOC105803019 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 190aa MW: 19697.8 Da PI: 5.3207 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.1 | 4.8e-57 | 25 | 120 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdrflPianvsrimkk+lP nakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa+ tlGfe+yveplk+yl kyre Gorai.001G222300.1 25 REQDRFLPIANVSRIMKKALPPNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMMTLGFEEYVEPLKIYLLKYRE 115 89***************************************************************************************** PP NF-YB 93 legek 97 +egek Gorai.001G222300.1 116 MEGEK 120 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-54 | 20 | 128 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.17E-40 | 27 | 129 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.4E-28 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.5E-20 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.5E-20 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 3.5E-20 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MADSDDESGE QNHNGGNAHS EASGREQDRF LPIANVSRIM KKALPPNAKI SKDAKETVQE 60 CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMMTLGFE EYVEPLKIYL LKYREMEGEK 120 SSMGRGEKDG ASGGSSGGAS GGGGGGGSVG GGGVGSGGGE FNGGGGMYGG MMMGHHQGHM 180 YSSGGFIIK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-47 | 25 | 115 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-47 | 25 | 115 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 135 | 147 | SGGASGGGGGGGS |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012490412.1 | 1e-133 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 3e-69 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0D2N3A5 | 1e-132 | A0A0D2N3A5_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.001G222300.1 | 1e-133 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-69 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.001G222300.1 |
Entrez Gene | 105803019 |
Publications ? help Back to Top | |||
---|---|---|---|
|