PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.001G064700.5 | ||||||||
Common Name | B456_001G064700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 113aa MW: 12719 Da PI: 4.9109 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 60.9 | 2.9e-19 | 11 | 80 | 3 | 72 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwala 72 ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c+re+++ti+++ +l al Gorai.001G064700.5 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCNREDKRTIAPEHVLKALE 80 6899**************************************************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-27 | 8 | 80 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-25 | 12 | 88 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.0E-22 | 14 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MEPMDIVGKS KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE 60 VCNREDKRTI APEHVLKALE VTPSPTYFHL SIWSFMCISS VLCFIKFEKV MP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 7e-24 | 12 | 88 | 12 | 87 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027329535.1 | 2e-52 | protein Dr1 homolog isoform X1 | ||||
Refseq | XP_027329536.1 | 3e-52 | protein Dr1 homolog isoform X2 | ||||
Swissprot | P49592 | 1e-50 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | A0A0D2PS80 | 6e-76 | A0A0D2PS80_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.001G064700.1 | 2e-51 | (Gossypium raimondii) | ||||
STRING | GLYMA05G07750.1 | 3e-51 | (Glycine max) | ||||
STRING | XP_009792100.1 | 3e-51 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08190.1 | 1e-53 | nuclear factor Y, subunit B12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.001G064700.5 |
Publications ? help Back to Top | |||
---|---|---|---|
|