PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ56544.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family HB-other
Protein Properties Length: 344aa    MW: 37860.4 Da    PI: 6.2473
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ56544.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-091961244
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHH CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqV 44
                ++R + t+ q e+Le+ ++ n++ps e+r+ L +++gLte+ V
  KXZ56544.1 19 KPRAQKTPLQKEVLEASYQLNQHPSIEHRKALGDRIGLTEQEV 61
                899*************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.19E-71161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-121361IPR009057Homeodomain-like
PfamPF000468.2E-71961IPR001356Homeobox domain
CDDcd000869.71E-62061No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEQPEPLLGA ADAKAKASKP RAQKTPLQKE VLEASYQLNQ HPSIEHRKAL GDRIGLTEQE  60
VALAAASGAV SGGGGSALSQ PTAGEEETED GDAEYDEAAA AAWDGFRALC TAARASLPVP  120
YREDGPPLGY LFDDPGEPDR VPGGGGGGGR KRRRIVLAGD VVEADDEVVK SVLLRKPAGE  180
KPGLPGSAPV GVMTQAELEM RRRELALQQQ MLAQQQLAAA AAAAGAGGDP ADPDFGAGRS  240
RAEDAVRREQ ERLRRELAKH SEKLERDRRR DEEERHRELE RGEKERRKLV DKLEKERAKE  300
EARKLKEMEK MKIAEERELR RLEAAREKER KAEERRRAVE ERKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149153RKRRR
2150154KRRRI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002958970.15e-67homeodomain protein
TrEMBLA0A150H3C10.0A0A150H3C1_GONPE; Uncharacterized protein
STRINGXP_002958970.12e-66(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP510588