PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ55984.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family HB-other
Protein Properties Length: 1749aa    MW: 168828 Da    PI: 6.5532
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ55984.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.41.5e-05159716292254
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox   22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54  
                  ++yps++e+e L +++gL+  q  +WF N R +
  KXZ55984.1 1597 HPYPSEDEKEVLCNSTGLDLLQLNNWFINARVR 1629
                  89*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.25615701633IPR001356Homeobox domain
SMARTSM003891.1E-415721637IPR001356Homeobox domain
SuperFamilySSF466893.55E-1415721641IPR009057Homeodomain-like
CDDcd000863.58E-815731633No hitNo description
Gene3DG3DSA:1.10.10.607.3E-2415761635IPR009057Homeodomain-like
PfamPF059208.0E-1615901629IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1749 aa     Download sequence    Send to blast
MAQQPYHTDY QSHQDWPDVG SPLQPQQQQQ QQLPQHLPPP AAAGPLPPLL ALPPLPRPPS  60
ASGVLTESVS APGALSRPEA GSPVSGDLAG GGLHYAAAAA GAGGGGGATG SPGSSGGGTR  120
KRPLSSAATF NEADFTAALG EAVRGHKARP PPPSEVMAAL AAAAAAATSG GGGASGMALD  180
FASGGTTAAA AAGEVTMVAA AAAAAEGAMQ ATDGERRSQL SSHTGLMLTG GSSGGGGATA  240
QAAAGQPPFA PAGPGPAAGG GQMLAGGDGG GGGGIAHATA PAAIGSGGGM AAAVAAAAAA  300
AAATGTVGGA AAWAPQQHAA ATPSEDSTSQ SMLVTPQCAP GAPLHHAPGP CPGSGAGHGP  360
GPGPGHGAAQ AFIAPGFAAG SSPVGSAAAM VAATTSGRGA PGPVSAPPYP YGGGAAAAEM  420
PPLQMPTAPL SAPPSTAPPT SSYAPQTGMP GLGRCFSDLS SYAYIMAMQG TPGGGGGGGG  480
GGGGGNGGGG ADPWVVAAAA SPMAAAAPPA GGTSGGLHPA PAAAGASGSG GSAAAAAMYG  540
MTLGAPPGSM PAGPWPQVAR VVVHSTRSNT RISSSRSSSS RSSSTALITR TLSSSSTLCS  600
SSSSRTSVAI TNPNYSTITG ISTARTTLME QLRAERERPA AGNNHIRNTS TNSTNSPTRA  660
AGGGGDGAVA VAPELGDGGG AGGAAAVAQE RGAPGGAGRR PPHRPPQGSL TASSSMEGGV  720
GDKTTAAATH TAAAGGGGAA AATPGLELLD TDHHASTTAS GGSLGRIVEM MFYQQPEDVA  780
GGGGGGGGGG AAGAAAAAAG VVRHATPVSP SPELLIRLAG GGGTDGRRTP GEAQGQDPGQ  840
QAVAAAAAAA VQEVARRLSP LLQPRLDSPD IFANWAVADE FAAQAASNNT ASDGGGGSGS  900
GGGATSGAGA EAAEWIRTPQ LDSLVADWVR GTPPPPSLLG LSDQFVPLQP LATPAPAPPQ  960
PAPPPAAATS PQDVHPGTVP KRAGAGPASV LELAAAGAIG DRNAGPGSSG ALTVATADAG  1020
ARPVANGLSS LPTSAAAEQY ATEATAATGR GGHGAAVTAL PLLPPAGGAA AAAADYAASS  1080
ALATLEALQT LMRTNIDPGA ASALLEELQY ITADPAAVGG GGGGSGGGSG GGSDELVRNP  1140
DADAEADVEA NVAAAGAAAA RPRAESDVGS TMRQQTPPQA LPPPLPLHLA PPASEPAGSR  1200
QQRQQQRPHP YSQHPSHPQL LLIQQQQQQQ QQQQQQQEQE QEHPRQEPPH LQHQDAVAMK  1260
RERYEASSVS HPAGPGPHSV GHLQRLLTEG GSFGGGGPDG AAGGQYPYQG AAHPQAGRGD  1320
PGAAAAAAAA AAAAAAAAAQ GWAFGLSDSS SPLHRAGSVG SMPVQVPQSS AAAAAAGDGR  1380
QRHTAYLAAP PTAPRADAGV DLYGTAYIGA QQQQQQQTRQ GQQQQQPHQQ QQQYGNWPSQ  1440
PYNEYDPLAA AIRQAHQAPP QSGPAVDMYG RQYDAMSVGA ADLAPPPQQG RVSYPGMHDT  1500
FSTVSTFGSG AGGGSSSNWT SLQGRVAAGA LAYGTSVAAP SRMINGRGLG FKASGGGGGG  1560
GGGGGANNGP GSKKGRENLP KTAVNSLKLW VYNHIVHPYP SEDEKEVLCN STGLDLLQLN  1620
NWFINARVRI WKPLITSVFN SNQPRMAQEA QARGDTELLG KMNAARNSPT AQLALVAADA  1680
TALTCLEQAA QAAAEELMAA AKATAGGGGG SKGGGGSSRR RGGGGGGGAG AGGGGGGGGS  1740
GESVSMEGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-1715791635157Homeobox protein Meis1
4xrs_B1e-1715791635157Homeobox protein Meis1
5bng_A1e-1715791635157Homeobox protein Meis2
5bng_B1e-1715791635157Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150H1Q00.0A0A150H1Q0_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP321077
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.18e-18BEL1-like homeodomain 11