PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.U040700.1.p | ||||||||
Common Name | GLYMA_U040700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 174aa MW: 19998.2 Da PI: 10.5881 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 60.6 | 1.8e-19 | 21 | 68 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 + n+sn vtfskRr+ ++KKA+EL +LC+++v vi+fs+ ++++ + Glyma.U040700.1.p 21 KMRNESNLRVTFSKRRTRVFKKASELATLCGVDVVVIMFSPGNRVFSF 68 5689****************************************9988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 22.904 | 12 | 72 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.0E-27 | 12 | 71 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.98E-26 | 13 | 94 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-16 | 14 | 34 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-21 | 22 | 68 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-16 | 34 | 49 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-16 | 49 | 70 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MPDLNGVAKK TKGRQKIEMK KMRNESNLRV TFSKRRTRVF KKASELATLC GVDVVVIMFS 60 PGNRVFSFGS PSVDSVVQRY KTQGPPPLLT LDLNKVHSTV DEVELHTHLH YLSNQIAIEK 120 KRTKDLNHLA KAAEDQFWWA RPIESMTDSQ LDKYKMLEEF KRQLKEKRGN LNL* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.U040700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC235843 | 0.0 | AC235843.2 Glycine max clone GM_WBb0059O09, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003537139.1 | 1e-127 | agamous-like MADS-box protein AGL62 | ||||
Refseq | XP_028184633.1 | 1e-127 | agamous-like MADS-box protein AGL62 | ||||
Swissprot | Q9FKK2 | 1e-38 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
TrEMBL | K7LI47 | 1e-126 | K7LI47_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA10G10690.2 | 1e-127 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13864 | 5 | 21 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 6e-41 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.U040700.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|