PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.20G209700.1.p | ||||||||
Common Name | GLYMA_20G209700, Glyma20g35180.1, GmMYB29B2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 273aa MW: 31152 Da PI: 5.9869 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.5 | 2.3e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W teEd++l +++++G g+W++ ++ g+ R++k+c++rw +yl Glyma.20G209700.1.p 14 KGPWATEEDQILTSYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 50.9 | 3.5e-16 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T eE+e +++++++lG++ W++Ia++++ gRt++++k+ w++ Glyma.20G209700.1.p 67 RGNFTIEEEETIIKLHEMLGNR-WSAIAAKLP-GRTDNEIKNVWHTN 111 89********************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.8E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.229 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.91E-30 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.82E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.801 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.6E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.1E-15 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.51E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 273 aa Download sequence Send to blast |
MVRAPCCEKM GLKKGPWATE EDQILTSYIQ KHGHGNWRAL PKQAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TIEEEETIIK LHEMLGNRWS AIAAKLPGRT DNEIKNVWHT NLKKRLLKSD 120 QSKPSSKRAT KPKIKRSDSN SSIITQSEPA HLRFREMDTT STACNTSSSD FSSVTVGDSK 180 NIIKSEDIES METMPVIDES FWSEAAIDDE TPTMSSQSLI TISNDMPLQY PFANYEETFQ 240 QSHAYDSNFD DGMDFWYDIF TRTNDSIELS EF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-26 | 12 | 116 | 5 | 108 | B-MYB |
1h8a_C | 3e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.3229 | 0.0 | flower| hypocotyl| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00375 | DAP | Transfer from AT3G23250 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.20G209700.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB029165 | 0.0 | AB029165.1 Glycine max GmMYB29B2 gene, complete cds. | |||
GenBank | BT097117 | 0.0 | BT097117.1 Soybean clone JCVI-FLGm-21J11 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001241018.1 | 0.0 | MYB/HD-like transcription factor | ||||
Refseq | XP_028222896.1 | 0.0 | transcription factor MYB13-like | ||||
Swissprot | Q9LTC4 | 4e-83 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | A0A445F876 | 0.0 | A0A445F876_GLYSO; Transcription factor MYB15 | ||||
TrEMBL | Q9XIU5 | 0.0 | Q9XIU5_SOYBN; GmMYB29B2 protein | ||||
STRING | GLYMA20G35180.1 | 0.0 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 2e-85 | myb domain protein 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.20G209700.1.p |
Entrez Gene | 100807569 |