PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.20G111800.1.p | ||||||||
Common Name | 1-3-1B, GLYMA_20G111800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 237aa MW: 26725.7 Da PI: 6.5238 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44 | 5.1e-14 | 122 | 166 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++G+g+W++I+r + +Rt+ q+ s+ qky Glyma.20G111800.1.p 122 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 166 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 0.0012 | 13 | 65 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.54E-10 | 15 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.226 | 17 | 63 | IPR017877 | Myb-like domain |
CDD | cd00167 | 5.04E-5 | 17 | 63 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.4E-4 | 37 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.947 | 115 | 171 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.83E-17 | 117 | 172 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.9E-17 | 118 | 170 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 7.3E-11 | 119 | 169 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-11 | 119 | 165 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.4E-12 | 122 | 166 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.34E-9 | 122 | 167 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MFQESSATRW PTQPTQWTRY HDKLFERALL VVPEDLPDRW EKIADQVPGK SAVEVREHYE 60 ALVHDVFEID SGRVEVPSYV DDSVATPPSG GAEISTWDNA NQISFGSKPK QQGDNERKKG 120 TPWTEEEHRL FLIGLSKFGK GDWRSISRNV VVTRTPTQVA SHAQKYFLRQ NSVKKERKRS 180 SIHDITTVDS NSVPVPIDQN WVPPPGGSVQ QSLQYPSSNM LDQMGTFGYS NYGFGM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 1e-13 | 6 | 79 | 2 | 73 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.121 | 0.0 | stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 19911578 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.20G111800.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB083028 | 0.0 | AB083028.1 Glycine max mRNA for syringolide-induced protein 1-3-1B, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001237103.1 | 1e-176 | syringolide-induced protein 1-3-1B | ||||
Refseq | XP_028219573.1 | 1e-176 | transcription factor SRM1-like | ||||
Swissprot | Q9FNN6 | 9e-60 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A445F3L1 | 1e-175 | A0A445F3L1_GLYSO; Transcription factor SRM1 | ||||
TrEMBL | Q8S8Z9 | 1e-175 | Q8S8Z9_SOYBN; Syringolide-induced protein 1-3-1B | ||||
STRING | GLYMA20G24600.1 | 1e-175 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6068 | 32 | 51 | Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-83 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.20G111800.1.p |
Entrez Gene | 547481 |
Publications ? help Back to Top | |||
---|---|---|---|
|