PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.19G085700.1.p | ||||||||
Common Name | GLYMA_19G085700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 159aa MW: 18735.4 Da PI: 9.9072 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59 | 1.1e-18 | 30 | 73 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+++T+eE+e+l+ ++ +G++ W+ Iar+++ gRt++ +k++w+ Glyma.19G085700.1.p 30 RNPFTEEEEERLLASHRIHGNR-WAVIARHFP-GRTDNAVKNHWHV 73 789*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.35E-22 | 13 | 79 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 6.2E-9 | 14 | 37 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.25 | 25 | 79 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-16 | 29 | 77 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 30 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.09E-12 | 32 | 72 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.4E-18 | 38 | 73 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MWLYSPEFEG IIWKSCRLRW FNQLDPRINR NPFTEEEEER LLASHRIHGN RWAVIARHFP 60 GRTDNAVKNH WHVIMARIRR ERSKINNPKL QPLFAPNLKD DLEAIPSFVE KYYEKYSHPC 120 VTLTHSSFQF PGKKFYFQDP SSAGSTVPPV SIAERKEL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-20 | 3 | 77 | 32 | 106 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.52526 | 0.0 | flower |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21399993}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.19G085700.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT092893 | 0.0 | BT092893.1 Soybean clone JCVI-FLGm-12J9 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025982841.1 | 1e-101 | transcription factor MYB21-like | ||||
Swissprot | Q6R0C4 | 2e-42 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A445KE36 | 1e-114 | A0A445KE36_GLYSO; Transcription factor MYB52 | ||||
TrEMBL | K7MXB7 | 1e-114 | K7MXB7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA19G24770.2 | 1e-115 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF230 | 34 | 243 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 1e-44 | myb domain protein 52 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.19G085700.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|