PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.19G040300.1.p | ||||||||
Common Name | GLYMA_19G040300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 93aa MW: 10318.2 Da PI: 10.2793 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 91.3 | 8.1e-29 | 34 | 84 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kprl+Wtp+LHerF+eav++LGG +kAtPk +l+lm+++ Ltl+h+kSHLQ Glyma.19G040300.1.p 34 KPRLKWTPDLHERFIEAVNELGGVDKATPKIVLKLMGIPRLTLYHLKSHLQ 84 79************************************************* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.242 | 31 | 91 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-26 | 32 | 84 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.33E-13 | 33 | 86 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.4E-21 | 34 | 86 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.8E-8 | 36 | 85 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MHALRMHSPT ERHMMMHGGN GSGDSGLVLS TDAKPRLKWT PDLHERFIEA VNELGGVDKA 60 TPKIVLKLMG IPRLTLYHLK SHLQVTLFQL PI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_A | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.23782 | 1e-124 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.19G040300.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 2e-63 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006574747.1 | 1e-50 | myb-related protein 2 isoform X1 | ||||
Refseq | XP_006574748.1 | 1e-50 | myb-related protein 2 isoform X2 | ||||
Refseq | XP_020205825.1 | 5e-53 | myb-related protein 2 | ||||
Refseq | XP_028198916.1 | 1e-50 | myb-related protein 2-like isoform X1 | ||||
Refseq | XP_028198923.1 | 1e-50 | myb-related protein 2-like isoform X2 | ||||
Refseq | XP_028198930.1 | 1e-50 | myb-related protein 2-like isoform X3 | ||||
Refseq | XP_028198937.1 | 1e-50 | myb-related protein 2-like isoform X4 | ||||
Swissprot | Q9SQQ9 | 1e-37 | PHL9_ARATH; Myb-related protein 2 | ||||
TrEMBL | A0A445FC13 | 1e-60 | A0A445FC13_GLYSO; Myb-related protein 2 | ||||
TrEMBL | K7MWF6 | 1e-60 | K7MWF6_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA19G05385.1 | 2e-61 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15413 | 9 | 11 | Representative plant | OGRP78 | 17 | 262 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04030.1 | 5e-40 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.19G040300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|