PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.18G259200.1.p | ||||||||
Common Name | GLYMA_18G259200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 89aa MW: 10069.5 Da PI: 10.1948 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 50.8 | 3.8e-16 | 31 | 70 | 20 | 60 |
ZF-HD_dimer 20 havDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 vDG +Ef++s g+egt a++Ca C+CHRnFHR+e++++ Glyma.18G259200.1.p 31 RIVDGYREFVAS-GAEGTGGAMTCATCDCHRNFHRKEEQTQ 70 579********9.999********************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51523 | 10.162 | 18 | 66 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 9.5E-16 | 31 | 67 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 8.0E-11 | 33 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MKRVILRRDG RTRYSNNSLV TIVRHVRYIA RIVDGYREFV ASGAEGTGGA MTCATCDCHR 60 NFHRKEEQTQ MVCACSSHPT TQIRRHSN* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.18G259200.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022751923.1 | 4e-21 | mini zinc finger protein 2-like | ||||
Refseq | XP_022751924.1 | 4e-21 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 2e-14 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A0R0FD96 | 2e-58 | A0A0R0FD96_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA09G37320.2 | 1e-31 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF36633 | 2 | 2 | Representative plant | OGRP91 | 16 | 237 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 6e-17 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.18G259200.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|