PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.18G129900.1.p | ||||||||
Common Name | GLYMA_18G129900, LOC100775434 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 207aa MW: 23040.9 Da PI: 10.3671 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 39.5 | 1.3e-12 | 70 | 114 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + + G+g+W+ I+r + +Rt+ q+ s+ qky Glyma.18G129900.1.p 70 PWTEEEHRLFLLGLQNVGKGNWRGISRNFVMTRTPTQVASHAQKY 114 8*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.795 | 63 | 119 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.07E-16 | 65 | 118 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.7E-17 | 66 | 117 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.7E-9 | 67 | 117 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-11 | 69 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.69E-9 | 70 | 115 | No hit | No description |
Pfam | PF00249 | 5.2E-11 | 70 | 114 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006338 | Biological Process | chromatin remodeling | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0035066 | Biological Process | positive regulation of histone acetylation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003713 | Molecular Function | transcription coactivator activity | ||||
GO:0004402 | Molecular Function | histone acetyltransferase activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MCSAEKDGIM LFGVRLTVSD NNPTTLRKSA SMNNLSQYDS QPPHDPNAGY ASDDVVHPSR 60 HTRERKRGVP WTEEEHRLFL LGLQNVGKGN WRGISRNFVM TRTPTQVASH AQKYFLRCHR 120 QNRRRRRSSL FDITTNSVME PWPEKEEEQA AAPSTRLKPV LPVPQSSKMA ELDLNGKSLS 180 LKLSVSKPPI SNENFGGGGD SISSVA* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.23179 | 0.0 | leaf| pod |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.18G129900.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT091934 | 0.0 | BT091934.1 Soybean clone JCVI-FLGm-9M5 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003553216.1 | 1e-153 | transcription factor MYB1R1 | ||||
Refseq | XP_028213734.1 | 1e-153 | transcription factor MYB1R1-like | ||||
Swissprot | Q7XC57 | 3e-47 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A445FSG1 | 1e-152 | A0A445FSG1_GLYSO; Transcription factor MYBS3 | ||||
TrEMBL | K7MRR7 | 1e-152 | K7MRR7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA18G17143.1 | 1e-153 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5338 | 33 | 50 | Representative plant | OGRP394 | 16 | 99 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G70000.2 | 1e-57 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.18G129900.1.p |
Entrez Gene | 100775434 |
Publications ? help Back to Top | |||
---|---|---|---|
|