![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.18G077500.1.p | ||||||||
Common Name | GLYMA_18G077500, LOC100813580 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 189aa MW: 20136.5 Da PI: 6.9467 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.1 | 1.1e-57 | 23 | 118 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk yl+++r Glyma.18G077500.1.p 23 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKGYLQRFR 112 89**************************************************************************************** PP NF-YB 92 elegek 97 e+egek Glyma.18G077500.1.p 113 EMEGEK 118 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.3E-55 | 18 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.26E-40 | 25 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.1E-28 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.7E-20 | 56 | 74 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-20 | 75 | 93 | No hit | No description |
PRINTS | PR00615 | 4.7E-20 | 94 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MADSDNDSGG AHNAGKGSEM SPREQDRFLP IANVSRIMKK ALPANAKISK DAKETVQECV 60 SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFEDY VEPLKGYLQR FREMEGEKTV 120 AARDKDAPPP TNATNSAYES PSYAAAPGGI MMHQGHVYGS AGFHQVAGGA IKGGPVYPGP 180 GSNAGRPR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-50 | 17 | 113 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.29090 | 0.0 | cotyledon |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.18G077500.1.p |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 0.0 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006602134.1 | 1e-139 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_028214205.1 | 1e-139 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 3e-72 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q75IZ7 | 2e-71 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0R0F8V1 | 1e-138 | A0A0R0F8V1_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A445FQI4 | 1e-138 | A0A445FQI4_GLYSO; Nuclear transcription factor Y subunit B-3 | ||||
STRING | GLYMA18G08620.1 | 1e-139 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 5e-74 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.18G077500.1.p |
Entrez Gene | 100813580 |
Publications ? help Back to Top | |||
---|---|---|---|
|