PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.17G100000.1.p | ||||||||
Common Name | GLYMA_17G100000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 80aa MW: 8531.66 Da PI: 8.8534 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 96 | 3.1e-30 | 21 | 75 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 ++rY eC+kNhAa++Gg+avDGC+Efm+s egt aal+CaACgCHRnFH+rev Glyma.17G100000.1.p 21 NIRYGECQKNHAANTGGYAVDGCREFMAS-ACEGTNAALTCAACGCHRNFHKREVL 75 689*************************9.8889*******************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 3.0E-21 | 1 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 2.2E-28 | 22 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.7E-24 | 23 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.695 | 24 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MKKRQVVVKR DYATSSPAVG NIRYGECQKN HAANTGGYAV DGCREFMASA CEGTNAALTC 60 AACGCHRNFH KREVLHGVN* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.56871 | 1e-134 | hypocotyl| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:18713354}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.17G100000.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC235246 | 1e-131 | AC235246.1 Glycine max strain Williams 82 clone GM_WBb0033G13, complete sequence. | |||
GenBank | BT096516 | 1e-131 | BT096516.1 Soybean clone JCVI-FLGm-9P8 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001351505.1 | 7e-53 | mini zinc finger protein | ||||
Swissprot | Q2Q493 | 3e-28 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
TrEMBL | A0A445G4R6 | 2e-51 | A0A445G4R6_GLYSO; Mini zinc finger protein 3 | ||||
TrEMBL | C6TFX2 | 2e-51 | C6TFX2_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA17G10830.1 | 3e-52 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 | Representative plant | OGRP91 | 16 | 237 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18835.1 | 1e-30 | mini zinc finger |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.17G100000.1.p |