PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.17G051400.3.p | ||||||||
Common Name | GLYMA_17G051400, LOC100777544 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 214aa MW: 22992.9 Da PI: 9.5989 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.5 | 4.7e-33 | 73 | 129 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d p+YVNaKQy++Il+RRq+Rakle+++kl +ksrkpylheSRh+hAl+R RgsgGrF Glyma.17G051400.3.p 73 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-IKSRKPYLHESRHRHALNRVRGSGGRF 129 57****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.4E-36 | 71 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.834 | 72 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.7E-28 | 75 | 129 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 8.0E-25 | 75 | 97 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 77 | 97 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 8.0E-25 | 106 | 129 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MKPFLSNHTD SMYNCSQVGC SHPMAHTSYP CGDPYFGSSI VAYGPQAINQ QMVPQMLGLA 60 STRIALPVDL AEDGPIYVNA KQYHGILRRR QSRAKLEAQN KLIKSRKPYL HESRHRHALN 120 RVRGSGGRFL SAKQLPQSNA ELVTDAYQKK DASEAENHPS STGENASITF TAISALTSMS 180 SNSVNFPNMA GSSQCSGGLT FGAGALQCTS VGR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-23 | 73 | 134 | 2 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.28971 | 0.0 | flower| hypocotyl| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.17G051400.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT096576 | 0.0 | BT096576.1 Soybean clone JCVI-FLGm-15L7 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001240022.1 | 1e-159 | nuclear transcription factor Y subunit A-19 | ||||
Refseq | XP_006600160.1 | 1e-159 | nuclear transcription factor Y subunit A-19 isoform X1 | ||||
Refseq | XP_014624789.1 | 1e-159 | nuclear transcription factor Y subunit A-19 isoform X1 | ||||
Refseq | XP_028210333.1 | 1e-159 | nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_028210334.1 | 1e-159 | nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q9LNP6 | 9e-38 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | A0A445G2R5 | 1e-158 | A0A445G2R5_GLYSO; Nuclear transcription factor Y subunit A-3 isoform B | ||||
TrEMBL | C6TG32 | 1e-158 | C6TG32_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA17G05920.1 | 1e-158 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17590.4 | 4e-40 | nuclear factor Y, subunit A8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.17G051400.3.p |
Entrez Gene | 100777544 |
Publications ? help Back to Top | |||
---|---|---|---|
|