PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Glyma.16G084000.2.p

Organism

Glycine max

Taxonomic ID

3847

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

LBD

Protein Properties

Length: 51aa MW: 5885.85 Da PI: 9.7092

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.16G084000.2.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	49.5	1.2e-15	13	49	4	40
DUF260 4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGas 40 aCk+lrrkC dC+++pyfp ++p+kf nvhk+F+as Glyma.16G084000.2.p 13 ACKFLRRKCMLDCIFSPYFPPKEPQKFTNVHKIFRAS 49 9*********************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	13.546	9	50	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.3E-13	12	49	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 51 aa Download sequence Send to blast
MASSSYSNSP YDACKFLRRK CMLDCIFSPY FPPKEPQKFT NVHKIFRASF *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	3e-17	3	49	4	50	LOB family transfactor Ramosa2.1
5ly0_B	3e-17	3	49	4	50	LOB family transfactor Ramosa2.1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.53058	5e-62	stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269\|PubMed:12068116}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.16G084000.2.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT090839	1e-59	BT090839.1 Soybean clone JCVI-FLGm-5B3 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003553820.1	1e-22	LOB domain-containing protein 25 isoform X2
Refseq	XP_006604045.1	1e-22	LOB domain-containing protein 25 isoform X2
Refseq	XP_014626928.1	1e-22	LOB domain-containing protein 25 isoform X2
Refseq	XP_014626929.1	1e-22	LOB domain-containing protein 25 isoform X2
Refseq	XP_018859864.1	1e-22	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_018859865.1	1e-22	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_022740706.1	1e-22	LOB domain-containing protein 25-like isoform X1
Refseq	XP_022740707.1	1e-22	LOB domain-containing protein 25-like isoform X2
Refseq	XP_028217634.1	1e-22	LOB domain-containing protein 25-like isoform X2
Refseq	XP_028217635.1	1e-22	LOB domain-containing protein 25-like isoform X2
Refseq	XP_028217636.1	1e-22	LOB domain-containing protein 25-like isoform X2
Refseq	XP_028217638.1	1e-22	LOB domain-containing protein 25-like isoform X2
Swissprot	Q8L8Q3	6e-19	LBD25_ARATH; LOB domain-containing protein 25
TrEMBL	A0A0B2RLJ2	1e-28	A0A0B2RLJ2_GLYSO; LOB domain-containing protein 25 (Fragment)
STRING	GLYMA16G09720.1	2e-26	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27650.1	3e-21	LOB domain-containing protein 25

Link Out ? help Back to Top
Phytozome	Glyma.16G084000.2.p

Publications ? help Back to Top
Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310]