PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G211900.2.p
Common NameGLYMA_15G211900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family STAT
Protein Properties Length: 441aa    MW: 48336.4 Da    PI: 5.3205
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G211900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT201.85.9e-631522731122
                 STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeip 90 
                          ldvvl++a+gqpv+k+ ev asLlyad+g++ve++ d+eapLL+sydG+efss +rp+kll GrasfklkisqLsskcdnrLf i+f++p
  Glyma.15G211900.2.p 152 LDVVLSDAFGQPVDKENEVFASLLYADTGAPVENTADDEAPLLASYDGIEFSSCERPSKLLLGRASFKLKISQLSSKCDNRLFLISFCVP 241
                          8***************************************************************************************** PP

                 STAT  91 klkkypfleavskpirCisrsrntrsssltkk 122
                          kl +ypflea+s+pirCisrsrntr s+l++k
  Glyma.15G211900.2.p 242 KLGNYPFLEAYSRPIRCISRSRNTRVSTLVWK 273
                          **************************999886 PP

Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MLPVLLLHEE APETGNINSW TEVPHATVDF EFLLEKWVHV GCEVCPDHIQ LQINGEIVGE  60
KSLCSLLNKE SGSSHLKKLT LANVGGDGKS VQGYVHNFEI FPIITSIKDC HLKCPPLKLS  120
IDESSVSEIE EESDGVWGIV GGKASCRRNF SLDVVLSDAF GQPVDKENEV FASLLYADTG  180
APVENTADDE APLLASYDGI EFSSCERPSK LLLGRASFKL KISQLSSKCD NRLFLISFCV  240
PKLGNYPFLE AYSRPIRCIS RSRNTRVSTL VWKRSTALHC HSLSQSSAMD DRSLDLQHSS  300
HEAQANPLMK RFRLGQDKTS VSVKADPTIE QPDEECNSHV RTANQVENGF PTSLDGRSAN  360
FIEAEDSPSD SESIGEGKSP LNSMASRRNP ISDMTIFKYC LASLAERSLM LKEIATFASG  420
KEISELANHV SLYSGCSHHG *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.441080.0cotyledon| hypocotyl| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G211900.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-128AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597985.10.0SH2 domain-containing protein A isoform X1
RefseqXP_028204147.10.0SH2 domain-containing protein A-like isoform X1
TrEMBLK7MCS10.0K7MCS1_SOYBN; Uncharacterized protein
STRINGGLYMA15G27760.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-102SH2 domain protein B