PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G211900.1.p
Common NameGLYMA_15G211900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family STAT
Protein Properties Length: 511aa    MW: 56248.4 Da    PI: 4.9603
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G211900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT201.47.7e-632223431122
                 STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeip 90 
                          ldvvl++a+gqpv+k+ ev asLlyad+g++ve++ d+eapLL+sydG+efss +rp+kll GrasfklkisqLsskcdnrLf i+f++p
  Glyma.15G211900.1.p 222 LDVVLSDAFGQPVDKENEVFASLLYADTGAPVENTADDEAPLLASYDGIEFSSCERPSKLLLGRASFKLKISQLSSKCDNRLFLISFCVP 311
                          8***************************************************************************************** PP

                 STAT  91 klkkypfleavskpirCisrsrntrsssltkk 122
                          kl +ypflea+s+pirCisrsrntr s+l++k
  Glyma.15G211900.1.p 312 KLGNYPFLEAYSRPIRCISRSRNTRVSTLVWK 343
                          **************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498991.52E-726173IPR013320Concanavalin A-like lectin/glucanase domain
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MDTDAVGSEG YSPLKELRLE IEVKEGTFSL CFWLYLTSST TFPVTIIQQV FSDISESAPF  60
LVIDDNKRIH MLPVLLLHEE APETGNINSW TEVPHATVDF EFLLEKWVHV GCEVCPDHIQ  120
LQINGEIVGE KSLCSLLNKE SGSSHLKKLT LANVGGDGKS VQGYVHNFEI FPIITSIKDC  180
HLKCPPLKLS IDESSVSEIE EESDGVWGIV GGKASCRRNF SLDVVLSDAF GQPVDKENEV  240
FASLLYADTG APVENTADDE APLLASYDGI EFSSCERPSK LLLGRASFKL KISQLSSKCD  300
NRLFLISFCV PKLGNYPFLE AYSRPIRCIS RSRNTRVSTL VWKRSTALHC HSLSQSSAMD  360
DRSLDLQHSS HEAQANPLMK RFRLGQDKTS VSVKADPTIE QPDEECNSHV RTANQVENGF  420
PTSLDGRSAN FIEAEDSPSD SESIGEGKSP LNSMASRRNP ISDMTIFKYC LASLAERSLM  480
LKEIATFASG KEISELANHV SLYSGCSHHG *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.441080.0cotyledon| hypocotyl| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G211900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-128AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597986.10.0SH2 domain-containing protein A isoform X2
RefseqXP_028204149.10.0SH2 domain-containing protein A-like isoform X2
TrEMBLK7MCS10.0K7MCS1_SOYBN; Uncharacterized protein
STRINGGLYMA15G27760.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Representative plantOGRP59411618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-129SH2 domain protein B