PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.15G129900.3.p | ||||||||
Common Name | GLYMA_15G129900, LOC100809036 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 175aa MW: 19910.4 Da PI: 9.6371 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 101 | 1.2e-31 | 79 | 135 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+ekk +++rkpylheSRh hAlrR+Rg+gGrF Glyma.15G129900.3.p 79 EEPVFVNAKQYHGILRRRQSRAKAESEKKA-ARNRKPYLHESRHLHALRRARGCGGRF 135 69***************************9.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 7.0E-35 | 77 | 138 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.416 | 78 | 138 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.5E-27 | 80 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.6E-23 | 81 | 103 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 83 | 103 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.6E-23 | 112 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MKLMSSSSRN HKCSIYLQME FLMQVPPTYP YPDPYYRSIF APYDAQTYPP QPYGGNPMVH 60 LQLMGIQQAG VPLPTDTVEE PVFVNAKQYH GILRRRQSRA KAESEKKAAR NRKPYLHESR 120 HLHALRRARG CGGRFLNSKK DENQQDEVAS TDESQSNINL NSDKNELAPS DRTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-20 | 78 | 143 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.15G129900.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT146024 | 1e-136 | BT146024.1 Medicago truncatula clone JCVI-FLMt-11O7 unknown mRNA. | |||
GenBank | JQ918271 | 1e-136 | JQ918271.1 Medicago truncatula nuclear transcription factor Y subunit A6 (NF-YA6) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006597658.1 | 1e-129 | nuclear transcription factor Y subunit A-7 isoform X2 | ||||
Refseq | XP_014623583.1 | 1e-129 | nuclear transcription factor Y subunit A-7 isoform X2 | ||||
Refseq | XP_028203934.1 | 1e-129 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
Refseq | XP_028203936.1 | 1e-129 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
Swissprot | Q84JP1 | 2e-62 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A0R0GAY3 | 1e-127 | A0A0R0GAY3_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA15G13660.2 | 1e-109 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-48 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.15G129900.3.p |
Entrez Gene | 100809036 |
Publications ? help Back to Top | |||
---|---|---|---|
|