PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.15G027400.8.p | ||||||||
Common Name | GLYMA_15G027400, LOC100803893 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 190aa MW: 21370.3 Da PI: 9.7792 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 99.3 | 3.9e-31 | 69 | 125 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVN+KQy++Il+RRq Rakle+ +k +k rkpylheSRh+hAl+R+Rg gGrF Glyma.15G027400.8.p 69 EEPIYVNSKQYHAILRRRQYRAKLEALNKP-IKDRKPYLHESRHQHALKRARGAGGRF 125 69***************************9.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.1E-34 | 67 | 128 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.164 | 68 | 128 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.2E-26 | 70 | 125 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 4.1E-24 | 71 | 93 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 73 | 93 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 4.1E-24 | 102 | 125 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MGCVIRSFMG SQDFPFPPPL LDHRPILAHI ACHYADPCYS GLVAAAYSPQ SKPVETAPVR 60 IPLQLDFAEE PIYVNSKQYH AILRRRQYRA KLEALNKPIK DRKPYLHESR HQHALKRARG 120 AGGRFLNTKK QLQSNHTPGN IAESKMHHIE NYRDGADVSY AFNSDARNMQ NDAADKGGGT 180 TQQPLFVYM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-21 | 69 | 131 | 2 | 64 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.15G027400.8.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC235312 | 1e-144 | AC235312.1 Glycine max strain Williams 82 clone GM_WBb0071J06, complete sequence. | |||
GenBank | EU028314 | 1e-144 | EU028314.1 Glycine max clone BAC gmw1-6b18 genomic sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006597200.1 | 1e-141 | nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_006597201.1 | 1e-141 | nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Refseq | XP_014622861.1 | 1e-141 | nuclear transcription factor Y subunit A-3 isoform X1 | ||||
Swissprot | Q9LNP6 | 9e-41 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | A0A0R0FVT3 | 1e-140 | A0A0R0FVT3_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A0R0G469 | 1e-140 | A0A0R0G469_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA15G03175.1 | 1e-115 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17590.4 | 4e-43 | nuclear factor Y, subunit A8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.15G027400.8.p |
Entrez Gene | 100803893 |
Publications ? help Back to Top | |||
---|---|---|---|
|