PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.14G100100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 69aa MW: 8053.09 Da PI: 9.4982 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 93.7 | 1.3e-29 | 7 | 65 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+ ++pr+ YrC+ gC+vkk+ver+++dp++v++tYeg+H+h+ Glyma.14G100100.1.p 7 LDDGYRWRKYGKKMVKKCPNPRNNYRCSVDGCTVKKRVERDKDDPRYVITTYEGNHTHP 65 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.7E-30 | 2 | 66 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.15E-27 | 2 | 66 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.207 | 2 | 67 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.6E-31 | 7 | 66 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.1E-24 | 8 | 65 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 69 aa Download sequence Send to blast |
MSEIEVLDDG YRWRKYGKKM VKKCPNPRNN YRCSVDGCTV KKRVERDKDD PRYVITTYEG 60 NHTHPTSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-24 | 2 | 64 | 12 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-24 | 2 | 64 | 12 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.14G100100.1.p |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006601221.1 | 8e-41 | probable WRKY transcription factor 50 isoform X1 | ||||
Refseq | XP_014625132.1 | 7e-41 | probable WRKY transcription factor 50 isoform X2 | ||||
Refseq | XP_028210037.1 | 8e-41 | probable WRKY transcription factor 50 isoform X1 | ||||
Refseq | XP_028210038.1 | 7e-41 | probable WRKY transcription factor 50 isoform X2 | ||||
Swissprot | Q8VWQ5 | 4e-33 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A0B2P9J3 | 4e-43 | A0A0B2P9J3_GLYSO; Putative WRKY transcription factor 50 | ||||
TrEMBL | A0A0R0GBZ6 | 4e-43 | A0A0R0GBZ6_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA14G11440.2 | 4e-44 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-35 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.14G100100.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|