PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Glyma.14G069100.1.p

Common Name

GLYMA_14G069100

Organism

Glycine max

Taxonomic ID

3847

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB_related

Protein Properties

Length: 188aa MW: 21186.2 Da PI: 9.2869

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.14G069100.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58	2.2e-18	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d+++ +G g+W++I++ g++R++k+c++rw++yl Glyma.14G069100.1.p 13 KGAWSKQEDQKLIDYIRVHGEGCWRSIPKAAGLHRCGKSCRLRWLNYL 60 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.4E-25	4	69	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.514	8	64	IPR017930	Myb domain
SMART	SM00717	2.4E-15	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	7.8E-17	13	60	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.83E-19	14	81	IPR009057	Homeodomain-like
CDD	cd00167	4.01E-12	15	60	No hit	No description
PROSITE profile	PS50090	4.31	61	95	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.4E-4	86	112	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 188 aa Download sequence Send to blast
MRKPCCDKES INKGAWSKQE DQKLIDYIRV HGEGCWRSIP KAAGLHRCGK SCRLRWLNYL 60 RPDIKRGIFA EDEEDLIIKL MPSLVTDNEV KNYWNSHIRR KLIKMGIDPN NHKPHQSFPR 120 SHASTEGAST SESMNKVPFF KSSGVAASDH RISFTKEETA IISSSSPPLN LDLTIALPSP 180 MLRAAEE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-17	10	102	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.14G069100.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT090465	1e-121	BT090465.1 Soybean clone JCVI-FLGm-4F17 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028200149.1	1e-129	myb-related protein 308-like
Swissprot	P81393	2e-59	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	1e-58	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A0R0GA81	1e-137	A0A0R0GA81_SOYBN; Uncharacterized protein
STRING	GLYMA14G07510.1	1e-132	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF264	34	221
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	4e-61	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Glyma.14G069100.1.p

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]