PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G337400.1.p
Common NameGLYMA_13G337400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 744aa    MW: 84066.1 Da    PI: 5.8894
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G337400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS380.52e-1163687401373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ cA+avss+d++ a++lL+++++++s  gd+ qRla+y+++AL+arl++  ++++ ++   + ++ ++++ l a+++f  ++P+
  Glyma.13G337400.1.p 368 LRTLLILCAQAVSSSDNRTANELLKQIRQHSSALGDASQRLAHYVANALEARLVG--DGTATQIFYMSYKKFTTTDFLRAYQVFISACPF 455
                          5789**************************************************9..555444544444445699*************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           kf+h+ aN++I++ ++g+e++HiiDf+i +G+QWp L++ L+ Rp+gpp+lRiTg++ p++g   +e++eetg+rLak++++++vpfe+
  Glyma.13G337400.1.p 456 KKFAHFFANKMIMKTADGAETLHIIDFGILYGFQWPILIKFLSRRPGGPPKLRITGIEYPQPGfrPTERIEETGRRLAKYCKRFNVPFEY 545
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          ++++++++e++++e+L+++++E laVn+ ++ ++lldes +++s+r++vL+l+++++P+++v++  + ++n++ Fl+rf eal +ys+++
  Glyma.13G337400.1.p 546 KAIASRNWETIQIEDLKIERNELLAVNCLVRFKNLLDESIEVNSPRNAVLNLIRKMKPDIFVHSVVNGSYNAPFFLTRFREALFHYSSIY 635
                          **9999************************************************************************************ PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d++++ ++re+e+r ++Ere+lgrei+nvvace  er+er et+++W++r ++aGFk++pl+++++++ +  lr+ + + +  +e+ +++
  Glyma.13G337400.1.p 636 DMFDTLISRENEWRLMLEREFLGREIMNVVACEALERVERPETYKQWQARNTRAGFKQLPLDKEIMTKFRGKLREWYHRDFVFDEDGNWM 725
                          *****************************************************************************999********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r L++ ++W
  Glyma.13G337400.1.p 726 LQGWKGRILYASTCW 740
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.259342721IPR005202Transcription factor GRAS
PfamPF035147.0E-114368740IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MLVFSFPPYA LVLFHISLAS MDPNFIISGY DFDESNHWDL NGHYANLLND AFSDVGPLGL  60
SQNAILNSEP FVSSSGSAAT DPAATTATLA DPSPEEDTDF SETFKFISQI LLEENFEQKP  120
CMCYDPLTLQ HTEKSFYEAL ELEPSLPLSP NQHPLESPDG NSSNSISDSA NSHDLKPSSP  180
NTPVSDALHS SSHAPSFVVP PHALNKINDG TVDLDSSVTK LLAENIFSDT DSMLQFKRGL  240
EEASKFLPRR PQLFTGLEST AVSAEPKGKG VALKMENSIG VRSRKNHARQ DEEEEEERSN  300
KQSAVSAVCV EEESEISEIF DRVLLSVENV PLCAEKNGSV AQAEKSNLSD GGKVRSKRQG  360
RKKETVDLRT LLILCAQAVS SSDNRTANEL LKQIRQHSSA LGDASQRLAH YVANALEARL  420
VGDGTATQIF YMSYKKFTTT DFLRAYQVFI SACPFKKFAH FFANKMIMKT ADGAETLHII  480
DFGILYGFQW PILIKFLSRR PGGPPKLRIT GIEYPQPGFR PTERIEETGR RLAKYCKRFN  540
VPFEYKAIAS RNWETIQIED LKIERNELLA VNCLVRFKNL LDESIEVNSP RNAVLNLIRK  600
MKPDIFVHSV VNGSYNAPFF LTRFREALFH YSSIYDMFDT LISRENEWRL MLEREFLGRE  660
IMNVVACEAL ERVERPETYK QWQARNTRAG FKQLPLDKEI MTKFRGKLRE WYHRDFVFDE  720
DGNWMLQGWK GRILYASTCW VPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-493517421379Protein SCARECROW
5b3h_D3e-493517421379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G337400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025981534.10.0LOW QUALITY PROTEIN: uncharacterized protein LOC100779806
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLK7M3F60.0K7M3F6_SOYBN; Uncharacterized protein
STRINGGLYMA13G41240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]