![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.13G311200.4.p | ||||||||
Common Name | GLYMA_13G311200, LOC100815973 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 168aa MW: 18693.3 Da PI: 9.9226 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 197 | 8.1e-61 | 2 | 144 | 22 | 170 |
YABBY 22 lavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevpr 111 ++vsvP +sl+++vtvrCGhC++ll+vn+ + q+ ++++ + + + + + ++++l++++ +++ +s + +++++ ++++ pr Glyma.13G311200.4.p 2 MVVSVPCSSLLTIVTVRCGHCANLLTVNMGASLQTFPSQDT---TQRFSTVGK--LQRQHLSVQEACSKELGSSSKCKTFETVDHDQQPR 86 89*************************************97...333333444..44444544444444444444444566666777799 PP YABBY 112 vppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 +pp irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl Glyma.13G311200.4.p 87 IPP-IRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 144 999.9****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 6.3E-62 | 2 | 144 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.83E-8 | 89 | 137 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 3.2E-5 | 92 | 138 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MMVVSVPCSS LLTIVTVRCG HCANLLTVNM GASLQTFPSQ DTTQRFSTVG KLQRQHLSVQ 60 EACSKELGSS SKCKTFETVD HDQQPRIPPI RPPEKRQRVP SAYNRFIKEE IQRIKASNPD 120 ISHREAFSTA AKNWAHFPHI HFGLKLDGNK QAKLDQGDGT QKSNGFY* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.9656 | 0.0 | flower| leaf| pod| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.13G311200.4.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT095127 | 1e-177 | BT095127.1 Soybean clone JCVI-FLGm-6F4 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014621489.1 | 1e-124 | transcription factor YABBY14 isoform X3 | ||||
Swissprot | Q9XFB0 | 3e-65 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | A0A0R0H716 | 1e-123 | A0A0R0H716_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA13G38750.1 | 1e-102 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 8e-59 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.13G311200.4.p |
Entrez Gene | 100815973 |
Publications ? help Back to Top | |||
---|---|---|---|
|