PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G062200.1.p
Common NameGLYMA_12G062200, LOC100815586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 661aa    MW: 74180.1 Da    PI: 6.5798
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G062200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS376.14.5e-1152876571373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ cA+avss+d+  a++lL++++++asp gd +qRla++f++AL+arla++++++y al+ ++ts    ++ ++a++++  ++P+
  Glyma.12G062200.1.p 287 LRTLLILCAQAVSSDDHVSANELLKQIKQHASPLGDGTQRLAHCFANALEARLAGTGTQIYTALSHKRTS---AADMVKAYQMYISACPF 373
                          5789************************************************************999999...99*************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k+s + aN++Il+ +++ e++HiiDf+i +G+QWpa++  L+++p+gpp+lRiTg++ p++g   +e+++etg rLa+++++++vpfef
  Glyma.12G062200.1.p 374 KKLSMIFANHTILQLAKEVETLHIIDFGIRYGFQWPAFIYRLSKQPGGPPKLRITGIELPQPGfrPAERVQETGLRLARYCDRFNVPFEF 463
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ +a+++e++++e+L++k++E l+ n +++ ++llde+v ++s+rd+vLkl+++ +P ++ ++  + ++n++ F++rf eal +ys+lf
  Glyma.12G062200.1.p 464 NA-IAQKWETIKIEDLKIKENELLVANAMFRFQNLLDETVVVNSPRDAVLKLIRKANPAIFLHATVNGSYNAPFFVTRFREALFHYSTLF 552
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d l+++++re+  r + Ere++gr+++n+vaceg+er+er et+++W+ r ++aGFk++pl+++  ++ ++ l+ v+   +++ e+ + +
  Glyma.12G062200.1.p 553 DVLDTNVAREDPMRLMFEREFFGRQVMNIVACEGSERVERPETYKQWQVRNMRAGFKQLPLDKHLINKLRCKLKGVYHSDFMLLEDGNYM 642
                          *****************************************************************************777********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r +++ S+W
  Glyma.12G062200.1.p 643 LQGWKGRVVYASSCW 657
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.18261638IPR005202Transcription factor GRAS
PfamPF035141.6E-112287657IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MLMEEDLEAK PCMFHDSLAL QAAEKSFYEV IGETYPSSSS SSSIQNYHNV DSPDESSFSG  60
TTTSTGNSFG SQWNNVDLAD YKPSILQTTF PTDFVFQASS IQSSMNTTSK FAVTNSEFLA  120
SSAAGFLGPG STNLFSKSES VLQFERGVEE ANKFLPKGNP LVIDLENPSF RMVPLQQEEI  180
KAERDIDEIS AESRGRKNHE REDEETDLQD GRSNKQSAVY IDDSEISELL DKVLLGTWCR  240
NEPAPSCIGY TDLPSGPSLG KLEETNKSGG GKSRVKKQGN KKGVVDLRTL LILCAQAVSS  300
DDHVSANELL KQIKQHASPL GDGTQRLAHC FANALEARLA GTGTQIYTAL SHKRTSAADM  360
VKAYQMYISA CPFKKLSMIF ANHTILQLAK EVETLHIIDF GIRYGFQWPA FIYRLSKQPG  420
GPPKLRITGI ELPQPGFRPA ERVQETGLRL ARYCDRFNVP FEFNAIAQKW ETIKIEDLKI  480
KENELLVANA MFRFQNLLDE TVVVNSPRDA VLKLIRKANP AIFLHATVNG SYNAPFFVTR  540
FREALFHYST LFDVLDTNVA REDPMRLMFE REFFGRQVMN IVACEGSERV ERPETYKQWQ  600
VRNMRAGFKQ LPLDKHLINK LRCKLKGVYH SDFMLLEDGN YMLQGWKGRV VYASSCWVPA  660
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-522706591379Protein SCARECROW
5b3h_D3e-522706591379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.12G062200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028192193.10.0scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLI1LQP50.0I1LQP5_SOYBN; Uncharacterized protein
STRINGGLYMA12G06670.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]