PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G062000.1.p
Common NameGLYMA_12G062000, LOC100809160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 681aa    MW: 77290.9 Da    PI: 5.3022
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G062000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.93.3e-1133086771373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ c + v ++d+++a++lL+++++++sp+gd++qRla+yf+++L+arl++  +++++ l++++++    +e l+a++ f  vsP+
  Glyma.12G062000.1.p 308 LRNLLMMCSQSVYANDKRAANELLEQIRQHSSPSGDALQRLAHYFANGLEARLVG--EGMFSFLKSKRST---AAEFLKAHQDFLSVSPF 392
                          689***************************************************9..9999999999888...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           kf+++ aN++I++a+ ++e+vHiiDf+i++G+QWp L++ L++R++gpp+lRiTg++ p++g   +e++eetg rLa++ ++  +pfe+
  Glyma.12G062000.1.p 393 KKFTYFFANKMIMKAAVKAETVHIIDFGIQYGFQWPMLIKFLSNREGGPPKLRITGIDFPQPGfrPTEKIEETGCRLANYSKRYSIPFEY 482
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+++++++e++++e+L+++++E +aVn+ ++ ++l+de+ +++s+r++vL+l+++++P++++ +  +  +n++ F +rf eal ++s+++
  Glyma.12G062000.1.p 483 NAIASRNWETIQVEALNIETNELVAVNSLMKFENLMDETIEVDSPRNAVLHLIRKINPHIFTQCIVNGTYNAPFFTTRFREALFHFSTIY 572
                          **9999************************************************************************************ PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d  ++ +pre+e+r+ +Ere+lgre++nv+aceg+er+er et+++W++r ++aGFk++pl+e+  ++ +  lrk + + + ++e+++++
  Glyma.12G062000.1.p 573 DLCDTVIPRENEWRMLIEREVLGREAMNVIACEGSERVERPETYKQWQARNMKAGFKQLPLNEELLAKFRNELRKSYHRDFVLDEDKNWM 662
                          *****************************************************************************999********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r L++ ++W
  Glyma.12G062000.1.p 663 LQGWKGRILYASTCW 677
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.668282658IPR005202Transcription factor GRAS
PfamPF035141.2E-110308677IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MEANFPRRAH QFGEEEESIL YVSDSLGFAA TDPSLRDPSL EDNDFSETAK FINQILMEDN  60
VEQMPFYDSL NLQVTEKSFY NALTGNIPLS PNQHPLVLSP QAETTPTTSN SSNNSNHNFL  120
DENSRELNPS PDSVSVLAFQ FNPNSLSQPP SVTVNHGLSN LDSSTAKLLA HNIFNDADSL  180
SQFRRGLEEA TRFLPPGPKL VAGLDSKGEE PINTLGENSY GSKGRKNHER EDIDTREEEE  240
RRSNKQSALS LVDESDLSDA FDRVVLLSVE NVCNEHCSLQ SETVKAVEPG GVKGRPKNQA  300
TNKETVDLRN LLMMCSQSVY ANDKRAANEL LEQIRQHSSP SGDALQRLAH YFANGLEARL  360
VGEGMFSFLK SKRSTAAEFL KAHQDFLSVS PFKKFTYFFA NKMIMKAAVK AETVHIIDFG  420
IQYGFQWPML IKFLSNREGG PPKLRITGID FPQPGFRPTE KIEETGCRLA NYSKRYSIPF  480
EYNAIASRNW ETIQVEALNI ETNELVAVNS LMKFENLMDE TIEVDSPRNA VLHLIRKINP  540
HIFTQCIVNG TYNAPFFTTR FREALFHFST IYDLCDTVIP RENEWRMLIE REVLGREAMN  600
VIACEGSERV ERPETYKQWQ ARNMKAGFKQ LPLNEELLAK FRNELRKSYH RDFVLDEDKN  660
WMLQGWKGRI LYASTCWVPA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-502916791379Protein SCARECROW
5b3h_D2e-502916791379Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.230360.0hypocotyl| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.12G062000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028193524.10.0scarecrow-like protein 14 isoform X1
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLI1LQP30.0I1LQP3_SOYBN; Uncharacterized protein
STRINGGLYMA12G06640.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]